KEGG   Takifugu rubripes (torafugu): 101072334Help
Entry
101072334         CDS       T02386                                 

Definition
gem-associated protein 7-like
Orthology
K13135  
gem associated protein 7
Organism
tru  Takifugu rubripes (torafugu)
Pathway
RNA transport
Module
Survival motor neuron (SMN) complex
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101072334
Spliceosome [BR:tru03041]
 Other splicing related proteins
  Proteins involved in snRNP biogenesis
   SMN complex factors
    101072334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 128 aa AA seqDB search
MAVPVSVIRLPKGPDPNSRGFDPNSPRFIALCRTSIPTSIPSDADAEQLQREQKARSQLR
ENFLRCLLSMTGKKVEFDMHENVKVEATFGASDIDVLNFQVSDLHTPIGVQKEALIRCQD
VISYTFEI
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgccagtgtcggtgatccgcctcccaaaaggtcccgaccccaacagtcgtgga
tttgaccccaactcgccccgcttcatcgctctgtgccgcaccagcatccccacttccatc
ccttcagatgctgacgccgagcagctgcagagagaacaaaaagcccgttcacagctgagg
gagaatttcctccgatgtctcctctccatgaccggcaagaaggttgagtttgacatgcac
gagaacgtaaaagtggaagccacgtttggagcatcggacattgatgtgctgaacttccag
gtttcagacctgcacactccaatcggggtgcaaaaagaggccttgataagatgtcaggat
gtgatttcatacacgtttgaaatttga

DBGET integrated database retrieval system