KEGG   Takifugu rubripes (torafugu): 101072512Help
Entry
101072512         CDS       T02386                                 

Definition
replication protein A 32 kDa subunit-like
Orthology
K10739  
replication factor A2
Organism
tru  Takifugu rubripes (torafugu)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    101072512
   03420 Nucleotide excision repair
    101072512
   03430 Mismatch repair
    101072512
   03440 Homologous recombination
    101072512
   03460 Fanconi anemia pathway
    101072512
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 274 aa AA seqDB search
MWNQGYNESNMAGGYTQSPGGFASPALSQGGEKKGRSRATQIIPCTVSQLMSASQADEAF
KVGDVEVVQITLVGVIRSTDKSMTNIQYKVDDMTAAPMDVKQWVDTEDPNVDSTVLPPDT
YVKVSGNLRSFQNHRSVVAFSVRPLEDMNEITSHMLEVVQAHMILGTPKSMGSGGGRVNS
NSTQMPRTNTETLGGSYTGVDMMANNGLSANQNQVLSLIRSCPYPQGISIQELKQRLSGI
GLSVIKQVVEFLSNEGHIFSTIDEDHYKSTDNDE
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatcagggttacaatgaatctaatatggccggtggttacacacaatctccggga
ggcttcgcatcacctgcgttatcccagggaggagagaagaaagggagatcccgtgctaca
cagataatcccctgcaccgtgtcgcagctcatgtcagcctcccaggccgacgaagccttt
aaagtaggagatgtagaagttgtccagattacgcttgtgggtgtcattagaagcacagac
aaatctatgaccaacatccagtacaaggtagatgacatgacggctgctcccatggatgtg
aagcaatgggtggacacagaggaccctaatgtggatagcactgtcctacctcctgacaca
tatgtgaaagtttctggcaatcttcgttcatttcaaaaccatagatctgttgtggcattc
agtgtcagacccctagaggacatgaatgaaatcacctcacacatgctggaagttgtccag
gcacacatgatccttgggacacctaagagcatgggtagcggtggaggacgagtgaacagt
aactccactcagatgccgcgaacaaacacagaaaccctaggagggagctacacaggagtg
gacatgatggccaacaatggattaagtgcaaaccagaatcaggtgctgagtttgatacga
agctgcccatacccccaggggatcagcattcaggaactgaaacagagactcagtggaata
ggcctgtcagtcataaaacaagtggtggaattcctaagcaatgaaggacacatcttttct
acaatcgatgaagaccactacaaatccacagacaatgatgaataa

DBGET integrated database retrieval system