KEGG   Takifugu rubripes (torafugu): 101072608Help
Entry
101072608         CDS       T02386                                 

Definition
60 kDa lysophospholipase-like
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     101072608
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     101072608
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     101072608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 597 aa AA seqDB search
MADYNLSSLGQDLQLTSPTTSEAHVLVINTGGTIGMTLHDNVLAPKPNAFVQSLRKLPIL
HDESHAICGSDNTLVLPMNKDNKRIIYTVMEYSPLLDSSNMTTDDWSQIGKDIEKNYQNF
DGFVILHGTDTMAYTASALSFMCEHLGKPIILTGSQVPIYQVRTDGIDNLLGALLIAGQF
VIPEVCLYFHNKLYRGNRVTKVDNRSFNAFSSPNLAPLANAAIDITINWDTVLRANTTAK
FQVSTELNSNVGLLKLFPGITTATVRAFLQPPMQGVVLETYGSGNAPDNRPDLLEELKKA
TDAGVIIINCTQCLRGTVSMSYATGKVLIDAGVITGGDMTSEAALSKLCYVLAKKELSLD
TKKKLMAQNLRGELSLDFAGTKLCLSDSRFIQVIAQSLHISCKEELAAIRDALTPPLACA
AAKIGDIEALEALKEMGSNLCLEDYDGRTPLHVAACEGHLNAVNYLLSHGATVYAKDRYG
DTPLCNAVHYRHRDIVELLRQTRAHFSQDRLEELGRELCSLAASGDLEGLEIWSLAGADL
MKPGYTGQTAIEVARAVGKHDVADWLSKLLRNKSETVVGGYYECDEYDDNGDELRHL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggcggactacaacctctcgtccctggggcaagacctgcagctgacctcgccaaccacc
tcagaggctcacgtcctggtcatcaacaccggggggaccatcggcatgacgctccacgat
aacgtgctcgccccaaaacccaacgctttcgtgcaaagtctgcgcaagttgcctatactc
cacgacgagtcgcatgcgatttgcggatctgacaacacgcttgtacttccgatgaataaa
gacaacaagaggatcatctacaccgtgatggagtacagtcctctgctggactcctctaac
atgaccacggacgactggagtcaaatcggaaaggacatcgagaaaaactaccagaacttt
gacggcttcgtgatcctccacggtaccgatactatggcctacacagcctccgccctgtcc
ttcatgtgcgaacacttgggtaaacccatcatcctgaccggctcccaggtgcccatctat
caggtgagaactgacggcatagacaacctgctgggggctttgctgatcgcgggccagttt
gtcattcctgaggtgtgcctttatttccacaacaaactctacagaggaaatcgcgtgacc
aaggtggataacaggagtttcaacgctttctcctctcccaacctggctcctctggccaac
gctgcaatagatattacgatcaactgggatacagtgttgagggccaacaccacagccaag
tttcaagtttccacggagctgaacagcaacgtgggtctgctcaagctgtttcctgggatc
accaccgccaccgtgagggctttcctgcagccacccatgcagggagtggtgttggagacc
tacggcagtggaaatgctcccgataaccgccctgacctgttagaagagctcaagaaggcc
accgacgccggggtaatcatcatcaactgcacgcagtgtctgaggggaactgtgtccatg
tcatatgcaaccggcaaggtgctgatcgatgctggggtgataaccggcggggacatgacc
tcagaggcggcgctgtcgaagctgtgctacgtactggccaagaaggagctcagtttagac
acaaagaaaaagctgatggctcagaacctccgcggtgagttgagtttggactttgcgggc
accaaactgtgcctgagcgacagccggttcatccaggtcatcgctcaatctctgcacatc
agctgcaaagaggagttagcagccattcgcgatgctctgacacccccgctggcctgtgct
gctgcgaagatcggagacatagaggccttagaagccctaaaagaaatgggcagtaacttg
tgtctggaagactacgatggccgcacacccctgcatgttgctgcctgtgagggccacctg
aatgcagtcaactaccttctgagtcacggtgccactgtctatgctaaagatcgctatggt
gacacgcctctgtgcaacgctgttcactacaggcacagggacatcgtggagctgctgaga
caaaccagagcccacttctcacaagacaggttggaagaacttggaagagaattgtgcagc
ctcgcagccagcggcgacctggagggcctggagatctggagcctcgcgggagcagatctg
atgaagccaggctacaccgggcagacggcaatcgaagtggcgcgggccgttggaaaacac
gatgtggcggattggctgtccaagctcctgaggaacaaatccgagacagtagttggtgga
tattatgagtgtgatgaatatgatgataatggtgatgagcttcggcacctgtaa

DBGET integrated database retrieval system