KEGG   Takifugu rubripes (torafugu): 101072802Help
Entry
101072802         CDS       T02386                                 

Definition
ubiquitin carboxyl-terminal hydrolase 48-like
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
tru  Takifugu rubripes (torafugu)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 1044 aa AA seqDB search
MAPRLQLEKAAWRWVETVKPEDITQEHINLAYRINLTACKRGTCRRNCRGNPNCLVAIGE
QAWLGEIDENTFHNIDDPNSERRDKNTFVGLTNLGATCYVNTFLQVWFHNLELRRSLYEC
NSSRAQEHNTGSDYEPQSICEHLQYLFALLQNSNRKYIDPSGLVKALGLDTGQQQDAQEF
SKLFLSLLENTLSKQKNTSLQNVIQRQFCGQFSYVTVCNQCGRSSALPSRFYELELNIQG
HKNLMECVTEFLKEEKLDGENRYFCESCQSKQSATRRIRLHSLPPTLNLQLMRFVFDRQT
GHKKKLNTFISFPEQLDMGPFLEGKQDQHSVYELSAVLIHRGISAYSGHYIAHVKDAHTG
DWYKFNDEEIEKMEGKKLQLGLEEDIAETVKSQTRKPKCTKGSHCSRNAYMLVYKVQEEQ
CSDSCRTSVEVPAFLQRLVDQDNHKFEEWCSEMADMRKQSVDKGKAKHEEVKELYELLPP
RDGQPYEFIPLDWLKKWLEDSTATKEIDNTPFLCSHGKLHPDMVGDSKRVSHQAAHLLYE
RYGGGPRLDGSCLCRECVGERCRVLRLKNQLNEDYKEVSNLVKRAASGNSFWVGKASLRG
WRQLALGQLKEDEQGITHGNIQTNGQGPHSNSKESGPELSEGNGDEMKTFNEDIVCCHGG
LSIQETERKLISVEVWAKLREYFPKAPEFSQNEEACPQCLMLEQEEKDNEAVSKMMALDQ
KNQLLNLFQEKNRPVLAKWPQGTNVLYIVPLFFVDEWKKFIRRPTKSSPVSNVGNTLLLC
PHGGFMFTYDSLINGDAQHIALLWPSEWEIISRLFIVDQQISIHRLTRTSPEGSCDQYTT
QPDLCWECRESFLFQQQRDLREYTQATVYVRKVVEDKRTIKEAAPELTASSSEAEEEKEE
HPKVDGEGDPDFSQSEDAAKRQKLSDGSAAMAANIPQLGGIRRSTRHRKLRGEKALIVSA
NQTLKELKIQIMHAFSVAPFDQNLSIDGKGLTDDSATLGSLGVVPESIICLKADEPVSDY
AAMDDVYQVGMPEEGFKGTGLLGH
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atggcgccccgcttacagctggagaaagcggcttggcgctgggtggaaacggtgaaacca
gaagacatcacgcaagagcacattaacctagcatatcgtatcaatctcacggcctgtaaa
aggggaacttgcaggaggaactgcagagggaatccaaactgcctggttgctattggtgag
caggcatggcttggagagatagatgaaaacaccttccacaatattgacgatccaaattca
gagcgtcgagacaagaacaccttcgtgggcctgaccaatctaggtgcaacatgttacgtc
aacacatttctgcaggtgtggttccacaacctggagctgcgccgcagcctttatgagtgc
aacagctccagagcgcaggaacacaacaccggttctgattatgagccccagtccatctgt
gagcatctgcagtatctgtttgcgctcttgcagaacagcaacaggaagtacattgacccc
tcgggtctggtcaaagctctgggcctggacactggccagcagcaggatgctcaggagttt
tccaagctcttcctgtccctgttggaaaacacgctgtccaaacaaaagaacaccagcttg
cagaacgtcatccagaggcagttctgtggacagttctcctatgtgacagtctgtaaccag
tgtggacgttcatcagcgctgccctccagattctacgagctagagctcaacatccagggt
cacaagaacctgatggagtgcgtcacagagttcctgaaggaggagaagctggatggggag
aaccgctacttctgtgagagctgtcagagtaagcagagcgccacccgcaggatcagactg
cacagcctccctccaaccctcaacctgcagctcatgcgtttcgtctttgacagacaaacg
ggccacaagaagaaacttaacaccttcatcagttttccagagcaactggacatggggcct
ttcctggagggaaaacaagatcagcactctgtgtacgagctgagtgcagtgctgattcat
cggggcatcagtgcatattctggccactacatcgctcatgtgaaggatgctcacaccggt
gactggtacaaattcaacgatgaggaaattgagaagatggaaggcaagaaacttcagctt
ggccttgaggaagacatcgctgagactgtgaaatctcagaccagaaaaccaaagtgcact
aaaggctcccactgctccaggaacgcatacatgttggtgtacaaagtccaggaagagcag
tgctcagattcctgcaggaccagtgtcgaggtgccagcttttcttcagaggttggtggac
caagacaaccacaaatttgaggagtggtgcagtgagatggcagacatgagaaaacagagc
gtggataagggcaaagccaagcatgaggaggtgaaggagctctacgagctattaccccca
agagacggtcagccatatgagtttatccctttggactggttaaaaaagtggctggaagat
tccactgcaacaaaggaaatagacaacacacccttcctgtgttctcatggcaaactgcac
ccagacatggtgggagactcaaagagggtctcccaccaagccgctcacctcctgtacgag
cgttacggcggaggacctcggctggatggctcttgtctgtgccgagagtgtgttggtgag
cggtgtagggtgctgcgtctgaaaaatcagctcaatgaagattacaaggaagtgtccaac
ctggtgaagagagcagccagtggcaacagcttctgggtgggtaaagcatctctccggggc
tggaggcaactggcattgggtcagctgaaggaggatgagcagggtatcacacatggaaac
atccagactaacgggcagggaccacacagcaacagcaaagagtcaggcccagagctgtcg
gaaggaaatggcgatgagatgaagacttttaacgaagacattgtctgttgtcacgggggt
ctcagtatccaggagacagagcggaaactgatttcagttgaggtttgggccaagctgagg
gagtactttcctaaagctccagaattcagccagaacgaagaggcctgtccgcagtgtctg
atgctggaacaggaagaaaaagacaatgaagctgtgagtaaaatgatggcactggaccag
aagaaccaattactcaacctcttccaggagaagaaccgtccagtgctggccaagtggcct
cagggcaccaacgtgctttacatcgttcctctgttttttgtggacgagtggaaaaagttc
atcaggagaccgacgaaatcgtcccccgtgtctaacgtgggcaacactctgctgctgtgt
ccacacgggggcttcatgttcacctatgactccctgatcaacggagacgcgcagcatata
gctttgctctggcccagcgaatgggaaatcatcagcaggctcttcatcgtagaccagcag
atctccatccaccgtctgacacggaccagccctgaaggatcctgtgatcagtacaccact
cagccggatctttgttgggagtgcagagagagcttccttttccagcagcagagggacctc
agggagtacacccaggcaaccgtctacgtccgcaaagtggtagaagacaagaggacgata
aaggaggcggcgccagaactgacagccagcagctctgaggctgaggaagagaaggaagaa
catccaaaggtggacggagagggagacccggatttcagccagtctgaagatgctgccaag
cgacaaaagttaagtgacggcagtgctgcaatggctgctaacataccccaactgggagga
atcaggaggagcactcggcacaggaagctgaggggagagaaagcgctcatcgtttcagcc
aatcagacgctcaaggagctgaaaatacagattatgcacgccttctctgtggcgccattt
gaccagaacctctccatcgatggcaaaggtctgacggacgactcggccactctgggcagt
ctgggcgtggtccccgagagcatcatctgtctgaaggcggacgagccagtgtcggactat
gccgccatggacgacgtgtatcaggtaggaatgcctgaagagggattcaaaggcactggc
cttcttggacactga

DBGET integrated database retrieval system