KEGG   Takifugu rubripes (torafugu): 101072867Help
Entry
101072867         CDS       T02386                                 

Definition
(RefSeq) circadian locomoter output cycles protein kaput-like
  KO
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:tru00001]
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101072867
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101072867
Transcription factors [BR:tru03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101072867
Chromosome [BR:tru03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    101072867
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 860 aa AA seqDB search
MTSSIDRDDSSIIDGLMEEDEKDKAKRVSRNKSEKKRRDQFNVLIKELGTMLPGNTRKMD
KSTILQNSIDFLHKHKEIAAQSESTEIRPDWKPPFLSNEEFTQLMLEALDGFFLAIMTDG
NIIYASESVTSLLEHLPSDLVDQNLLNFLPAGEHSEVYKALSSHIMEGETLSPEYLKTKN
QLEFCCHMLRGTIDPKEPPVYEYVKFIGNFKSLNNVPNCTQNGFEGVIQRSLQSAFEERV
CLIATVRLAKPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSG
YDYYHVDDLEILAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFI
VCTHTVVSYAEVRAEQRRELGIEESQPEMTAEKQSQDSGSESQLNTSSLKEVLDRFNRSR
TPSASSRSSRKSSHTAVSDPTSSQMKIQGDRSTPGRQSVSAVEMTSQRRSSISSQQSMSS
QNTGQNLAPTMVAQQPQPQQSQQQVQTSGQSMVQFCSQLEAMQNIKEQLEQRTRLIEANI
QRQQDELHQIQEELQRVQGQSLQMFLQKGAEEVNLSSVQMSAGNAVQQGGTLGMHGQVVS
TGPLQNSIQQPHPVQPLSQQQTLLREKNTAHAQSQRSSLTLQPQQNLPASLYNTMMIPQQ
SAANVVQIATSLAQNPGPNTPAVATFAQDHAAQIRFPAGPQLLTKLVTGQMACGAVMVPT
TMFMGQVVTAFASQQGQAQTISISQQPLQQQEQQQQQHQQQQQQQHQQQPPQVTAMQPGQ
APLAQQQTQFIQAPRLLHGNQSTQLILQAAFPLQQQGPFTASAQPQQQLQQLQQQQPLLQ
QKQASARRDSLSDRSAAQPQ
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgagcattgaccgggatgacagcagtatcattgatgggttaatggaagaagat
gagaaggacaaagcaaaacgtgtttcccgtaataagtctgagaagaaacgcagagatcag
ttcaatgtccttatcaaggagctgggcaccatgttgccgggcaacacccgcaagatggac
aaatccactattttacagaacagcattgactttttgcacaaacacaaagaaatcgctgct
cagtcagagtccactgagatcagaccagactggaagcctccttttcttagtaatgaagag
ttcacccagctgatgctggaggctttagatggctttttcctcgcaataatgactgatggg
aatataatctatgcgtctgagagtgtgacatccctacttgaacacttaccttctgacctt
gttgaccagaacctgttgaacttcttgcctgctggtgaacattcagaagtatataaggct
ctgtcctctcatatcatggaaggagagacactgtcacctgaatatttaaaaacaaaaaat
cagctggagttttgttgccacatgctccgagggacgattgaccccaaggagccgcccgtg
tatgaatatgtcaaatttattggaaacttcaagtccctgaataatgtgcctaactgtacc
cagaacggttttgaaggggtgatccagcgatcgcttcagtctgcctttgaagagagagtg
tgtctcatagcaaccgtcaggctcgccaagccgcagtttatcaaagagatgtgcactgtg
gaggaacctaatgaggaatttacctccagacatagtttagagtggaagtttctcttctta
gaccacagagctcctcctatcataggttacctcccctttgaggtgctgggtacgtcagga
tatgactattaccatgtagatgatctagagatcctggccaaatgtcacgagcacttaatg
caatatggtaaaggaaagtcctgctactacagatttctcaccaaagggcaacagtggatt
tggcttcagacacattactacatcacctatcaccagtggaactccaggccagagtttatt
gtctgcacacacactgtcgttagctatgctgaggtgagggcggagcaacgcagagagctc
ggtatagaagaatcccaacctgagatgacggcagagaagcaatcccaggattcagggtcc
gagtcccagctcaacacctccagcctgaaggaggttctcgaccgcttcaaccgcagtcgg
acgccttcggcgtcatcccgcagctcacgcaaatcctctcacaccgcggtgtcggacccc
acatcgtctcagatgaagattcagggtgaccggagtacaccgggtcgccagtctgtgtcc
gctgtggagatgacatcacagcgaaggtcgtccatcagcagtcagcagtcgatgagctct
caaaacacaggacagaatttggcaccgaccatggttgcccagcagccgcagccacaacag
tcgcaacagcaagtgcagaccagtggccaatcaatggtgcagttctgcagccaactcgag
gccatgcaaaatataaaagaacagctggagcagagaacgcggctgatcgaggccaacatt
cagcggcagcaggatgaactgcatcagatccaggaggagctccagagagtccagggtcag
agcctgcagatgttcctgcagaagggagctgaagaagtaaacctgagctcagttcagatg
tctgcggggaacgcggtgcagcaggggggaacgctcggcatgcacggccaggtggtgtcc
acggggcctctacagaacagcatacagcagccacatcctgtccaacccctgtcccagcaa
caaacgctgctgagggagaagaacacagcccacgcacagtctcagcgctcatctctcaca
ctgcagcctcaacaaaatctccccgcatcgctctacaacacgatgatgatcccgcagcag
agcgccgctaatgtggtccagatcgccaccagcctggctcagaatcctggacccaacacc
cccgccgtggctacttttgcacaggaccacgcggctcagattaggtttcctgctggtcct
cagctgctcaccaagctggtgacagggcagatggcatgcggagccgtcatggtacccaca
accatgttcatgggccaagtggtgacggcctttgcttcccagcagggtcaggctcaaacc
attagcatttcccaacaaccgctgcagcagcaggagcagcagcagcagcaacatcagcag
cagcagcagcagcaacatcagcagcaacccccccaggtcacagctatgcagccagggcag
gcaccgctggctcagcagcaaacacagttcatacaggctcctcgccttcttcatggaaac
cagtccacccagttgatcctgcaggcggcgttccctttgcagcagcagggtcccttcacc
gcctccgcgcagccgcagcagcagttacagcagcttcagcagcagcagccgctgctgcag
cagaaacaagcgtcggctcgcagagacagtttatccgatcgctccgccgcccagccgcag
tag

DBGET integrated database retrieval system