KEGG   Takifugu rubripes (torafugu): 101072867Help
Entry
101072867         CDS       T02386                                 

Definition
circadian locomoter output cycles protein kaput-like
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Herpes simplex infection
Class
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:tru05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
20
AA seq 855 aa AA seqDB search
MTSSIDRDDSSIIDGLMEEDEKDKAKRVSRNKSEKKRRDQFNVLIKELGTMLPGNTRKMD
KSTILQNSIDFLHKHKEIAAQSESTEIRPDWKPPFLSNEEFTQLMLEALDGFFLAIMTDG
NIIYASESVTSLLEHLPSDLVDQNLLNFLPAGEHSEVYKALSSHIMEGETLSPEYLKTKN
QLEFCCHMLRGTIDPKEPPVYEYVKFIGNFKSLNNVPNCTQNGFEGVIQRSLQSAFEERV
CLIATVRLAKPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSG
YDYYHVDDLEILAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFI
VCTHTVVSYAEVRAEQRRELGIEESQPEMTAEKQSQDSGSESQLNTSSLKEVLDRFNRSR
TPSASSRSSRKSSHTAVSDPTSSQMKIQGDRSTPGRQSVSAVEMTSQRRSSISSQSMSSQ
NTGQNLAPTMVAQQPQPQQSQQQVQTSGQFCSQLEAMQNIKEQLEQRTRLIEANIQRQQD
ELHQIQEELQRVQGQSLQMFLQKGAEEVNLSSVQMSAGNAVQQGGTLGMHGQVVSTGPLQ
NSIQQPHPVQPLSQQQTLLREKNTAHAQSQRSSLTLQPQQNLPASLYNTMMIPQQSAANV
VQIATSLAQNPGPNTPAVATFAQDHAAQIRFPAGPQLLTKLVTGQMACGAVMVPTTMFMG
QVVTAFASQQGQAQTISISQQPLQQQEQQQQQHQQQQQQQHQQQPPQVTAMQPGQAPLAQ
QQTQFIQAPRLLHGNQSTQLILQAAFPLQQQGPFTASAQPQQQLQQLQQQQPLLQQKQAS
ARRDSLSDRSAAQPQ
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atgacatcgagcattgaccgggatgacagcagtatcattgatgggttaatggaagaagat
gagaaggacaaagcaaaacgtgtttcccgtaataagtctgagaagaaacgcagagatcag
ttcaatgtccttatcaaggagctgggcaccatgttgccgggcaacacccgcaagatggac
aaatccactattttacagaacagcattgactttttgcacaaacacaaagaaatcgctgct
cagtcagagtccactgagatcagaccagactggaagcctccttttcttagtaatgaagag
ttcacccagctgatgctggaggctttagatggctttttcctcgcaataatgactgatggg
aatataatctatgcgtctgagagtgtgacatccctacttgaacacttaccttctgacctt
gttgaccagaacctgttgaacttcttgcctgctggtgaacattcagaagtatataaggct
ctgtcctctcatatcatggaaggagagacactgtcacctgaatatttaaaaacaaaaaat
cagctggagttttgttgccacatgctccgagggacgattgaccccaaggagccgcccgtg
tatgaatatgtcaaatttattggaaacttcaagtccctgaataatgtgcctaactgtacc
cagaacggttttgaaggggtgatccagcgatcgcttcagtctgcctttgaagagagagtg
tgtctcatagcaaccgtcaggctcgccaagccgcagtttatcaaagagatgtgcactgtg
gaggaacctaatgaggaatttacctccagacatagtttagagtggaagtttctcttctta
gaccacagagctcctcctatcataggttacctcccctttgaggtgctgggtacgtcagga
tatgactattaccatgtagatgatctagagatcctggccaaatgtcacgagcacttaatg
caatatggtaaaggaaagtcctgctactacagatttctcaccaaagggcaacagtggatt
tggcttcagacacattactacatcacctatcaccagtggaactccaggccagagtttatt
gtctgcacacacactgtcgttagctatgctgaggtgagggcggagcaacgcagagagctc
ggtatagaagaatcccaacctgagatgacggcagagaagcaatcccaggattcagggtcc
gagtcccagctcaacacctccagcctgaaggaggttctcgaccgcttcaaccgcagtcgg
acgccttcggcgtcatcccgcagctcacgcaaatcctctcacaccgcggtgtcggacccc
acatcgtctcagatgaagattcagggtgaccggagtacaccgggtcgccagtctgtgtcc
gctgtggagatgacatcacagcgaaggtcgtccatcagcagtcagtcgatgagctctcaa
aacacaggacagaatttggcaccgaccatggttgcccagcagccgcagccacaacagtcg
caacagcaagtgcagaccagtggccaattctgcagccaactcgaggccatgcaaaatata
aaagaacagctggagcagagaacgcggctgatcgaggccaacattcagcggcagcaggat
gaactgcatcagatccaggaggagctccagagagtccagggtcagagcctgcagatgttc
ctgcagaagggagctgaagaagtaaacctgagctcagttcagatgtctgcggggaacgcg
gtgcagcaggggggaacgctcggcatgcacggccaggtggtgtccacggggcctctacag
aacagcatacagcagccacatcctgtccaacccctgtcccagcaacaaacgctgctgagg
gagaagaacacagcccacgcacagtctcagcgctcatctctcacactgcagcctcaacaa
aatctccccgcatcgctctacaacacgatgatgatcccgcagcagagcgccgctaatgtg
gtccagatcgccaccagcctggctcagaatcctggacccaacacccccgccgtggctact
tttgcacaggaccacgcggctcagattaggtttcctgctggtcctcagctgctcaccaag
ctggtgacagggcagatggcatgcggagccgtcatggtacccacaaccatgttcatgggc
caagtggtgacggcctttgcttcccagcagggtcaggctcaaaccattagcatttcccaa
caaccgctgcagcagcaggagcagcagcagcagcaacatcagcagcagcagcagcagcaa
catcagcagcaacccccccaggtcacagctatgcagccagggcaggcaccgctggctcag
cagcaaacacagttcatacaggctcctcgccttcttcatggaaaccagtccacccagttg
atcctgcaggcggcgttccctttgcagcagcagggtcccttcaccgcctccgcgcagccg
cagcagcagttacagcagcttcagcagcagcagccgctgctgcagcagaaacaagcgtcg
gctcgcagagacagtttatccgatcgctccgccgcccagccgcagtag

DBGET integrated database retrieval system