KEGG   Takifugu rubripes (torafugu): 101072923Help
Entry
101072923         CDS       T02386                                 

Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2-like
Orthology
K05859  
phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tru00562]
Environmental Information Processing; Signal transduction; ErbB signaling pathway [PATH:tru04012]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:tru04370]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:tru04020]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:tru04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 1224 aa AA seqDB search
MAERGQQGEMTDYKKILIKRDLEMGAVMTVFRQKAERLTVQVIMETRQVAWTRTVDKTDG
VLDLFEIREIRPGRNSKDFERFKDGKDKHDDNACFTIFYGSQFVLNTLSLGVDSVAEAQK
WLTGLQLLWKETLEAPTPVLIESWLRKQMYSVNQTKTNSITVKELKALLPFLNYKAPSSR
TLKDKFQEVGSKKDRLDFEQFHKFYNHIMFEQNEVNILEEFKKESCAFILGNTDKPDASA
VMLHDFQRFLVYDQKESWAADLNQVRELMSIFIDDTMRKTNDPVFTVSEFLGYLFSEENS
IWDKKFSEISYIDMNNPLSHYWINSSHNTYLTGDQLRSESSTEAYVRALRLGCRCVELDC
WEGPGEPIIYHGWTRTTKIKFEDVVKAINDHAFVTSEFPVILSIEEHCPIEQQRQMARIF
REVFGDKLLTEPVEVIAEQLPSPTQLKGKIILKHKKLSVEGGGGGPIKDFRKGQKQGDLQ
IWDPVDRQWNKHYCVISDDKLYYAEEEEQEEEDTQKCTDLHSTEPWFHGHMNGGRQMAER
LIYEYCAETGGRDGTFLVRPSDRFALSYTLSFWRDGRVQHCRIRTASQEGRFYYYLTANL
HFPSLISLIQHYRENPLRCQDFELRLTDAVAQQNPHLHEGWFYSNLSRGEAEDYLIKIPR
DGAFLIRQREGEPDSFAITFKGDGQVKHCRIQKEGKRYLLGTTTDFESLVELVNYYRKKP
LYRKIKLRYTVTPELVERFSTSKSVVRALYSYQAARPDELSFSKGALIYNISKENGDWWK
GDYGGKVQHFFPANHVEEVSRITAPESSQQDLDDNPLGELCKGVIDISKCNILNLKNGKN
GKLHVLTLQDLEDDSLQFDLSAETLEELFKWYQAAWDITQRMISKEYNRQHEVEVEKKEE
VAMEMSDLVVYCQPRSKEKDRFDSYSYKEIRSFVENKVPGKSRTKEFLLYNRKALSRTYP
KGQRVESSNYDPYPLWAVGCHMVALNFQTADKYTQLNSALFSLNGCTGYVLQPEVMRSDS
FDPLQEKNKLQYIIDVRIIAARHLPRPGRSIASPFVEVELCGHTEEKFKTFVYRDNGLNP
VWKAPAEPITFRVYEAELTFLRFVVYEEDMFSDPNFLAQATFPVKGIRSGYRSVPLRNGY
SEKLELASLLVHVDARPAGRMEEDLYSSSSNLRKKSDVSSEPFLYDTHTNLQHHALPRQQ
NHLSREFSTNEKQRMKEKKINSKF
NT seq 3675 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacgggggcaacaaggggagatgaccgattacaagaagattctgatcaagcgg
gacttggagatgggtgcagtcatgacggtgttccgacagaaagcggagcggctcactgtg
caggtcatcatggagacccgacaggtggcttggacacgcactgtggacaagacagacggc
gtcttggacctgtttgagatccgagagatccgtcctggaaggaactccaaagactttgag
cgatttaaagatggcaaggacaaacatgatgacaacgcctgcttcacaattttctatggc
tcgcagtttgttctcaacacactcagcctcggggttgattctgtggctgaggcgcaaaaa
tggctgacaggactgcaactgttgtggaaagagacactggaggctcccactccagttctt
attgagagttggctaaggaagcagatgtactctgtcaatcagacaaagaccaacagcatc
accgtgaaggagttgaaggctctgcttcctttcctcaactataaggcccccagctctcga
acgctcaaagacaaatttcaggaagtggggtcaaagaaagatcgcctggatttcgagcag
tttcacaagttttacaatcatatcatgtttgaacagaatgaggtgaatattcttgaggag
ttcaaaaaggaatcgtgtgcgtttattctcggtaacactgataaacccgacgcttctgcc
gtcatgcttcatgatttccagagattcctcgtctatgatcaaaaggaaagctgggctgct
gatttgaaccaggtcagagaactgatgtccatcttcatcgacgacaccatgagaaaaacc
aacgaccccgtgttcaccgtcagtgagttcctcggttacctgttttcagaagagaacagt
atttgggacaaaaagttttctgagatcagctacatagacatgaacaaccctttatcccac
tactggatcaactcctcacacaacacatatctgactggagatcagcttcgtagtgaatca
tccacagaggcttacgtgcgagctctgcgtcttggatgccgctgtgtcgaattggactgc
tgggaaggacccggggagccaatcatttaccacggttggaccaggaccaccaaaatcaag
tttgaggatgtggtcaaagccattaacgatcatgcctttgttacatcagagtttccagtg
atcctgtccatcgaggagcattgccctatagagcagcagcgtcagatggctcggattttc
cgggaagtgtttggagacaagctgctgacggaacccgtggaggtgatagctgaacagctt
ccctcaccgacacagctgaaaggaaagatcatacttaagcacaagaagctgagcgtggag
ggaggaggaggaggacccattaaagacttcaggaaggggcagaaacagggagatctgcag
atctgggatcctgtggacaggcaatggaataaacactactgtgtgatctctgatgataag
ctgtattatgcagaggaagaagagcaagaggaagaggatactcagaagtgtacagacctg
cacagtacggagccctggtttcatggtcacatgaatgggggaaggcaaatggccgagcgg
ctgatctacgagtactgtgccgagacggggggacgggacgggaccttcttggtccggccc
agtgacagatttgctctaagctataccctgtccttctggcgtgacggacgggtccagcac
tgccgcattcgtacggcctcacaagagggacgcttttactattatctgacggcaaacctg
cactttcccagcttgatttccctgatccagcactacagagagaacccactacgctgccag
gattttgagctgcgtctcactgatgctgtagcacagcaaaacccacatctccacgaaggg
tggttctacagtaacttgagcagaggggaggcagaggattacctgataaagattcccaga
gacggagccttcctgattcggcagagagaaggagaaccggactcttttgccatcacgttc
aaaggcgatggtcaggttaagcactgccggatccagaaggaggggaagcgctacctgctg
ggcaccacgacagactttgagagcctggtggagctcgtcaactactacagaaagaagccg
ctgtatcggaagatcaagctacgttacaccgtcacgcccgagctcgtggagcgcttcagc
acatctaaaagtgtcgttcgagccctgtacagttaccaggccgcacggccggatgagctc
agcttcagtaagggagcgttgatctacaacatctccaaggagaacggcgactggtggaaa
ggtgactatggtggaaaagtgcagcatttctttccagccaatcacgtagaggaagtctcc
agaattacagctcctgagtccagtcagcaggacttggacgacaacccgctgggtgagctg
tgtaagggtgtcatagacatctccaaatgcaacattctaaacttgaagaacggcaaaaat
gggaagctccacgtgttgaccctgcaggacctggaggacgacagcctgcagtttgacctg
tctgctgagactctggaggagctgtttaaatggtaccaggctgcctgggacatcacccag
agaatgattagcaaggagtacaacaggcaacacgaggtggaagtggaaaagaaagaggag
gttgctatggagatgtcggacctggtggtctactgtcagccgcgcagcaaagagaaagac
cgctttgacagctacagctacaaagagatccgctccttcgtggaaaacaaggtgccggga
aagagccgcaccaaagaattcctgctgtacaaccgcaaagcgctgagccggacctatccc
aaaggtcagcgcgtggagtcctccaactatgacccgtacccactgtgggccgttggctgt
catatggtggcgctcaacttccagaccgcagataaatacacccagctgaacagcgccctc
ttcagtctgaatgggtgcacaggttacgtgctgcagccggaggtcatgcgctcggacagc
ttcgacccgctgcaggagaagaacaaactccagtacatcattgacgtcaggattattgct
gccagacacctccccaggcctggccgcagcatcgccagcccgtttgtggaggtggagctg
tgtggacacacggaggagaagtttaagacctttgtctatcgtgataatggtttgaaccca
gtgtggaaagccccggcagagcccataaccttcagagtgtacgaggccgagctcaccttc
ctgcgctttgtggtctacgaggaggacatgttctcagaccccaactttctggctcaggcc
acatttcctgttaaaggaatccgctcaggttaccgctccgttcctctgagaaacggctac
agcgaaaagttggagctagcctctctgctggttcacgtcgatgcgaggccagctgggaga
atggaggaggacttgtactcatcctctagcaacctgaggaagaagtcggatgtcagcagc
gagccgttcctgtacgacacgcacaccaacctccagcaccacgcccttccccgccagcag
aaccacctttcaagagagttcagcaccaacgagaagcagaggatgaaagaaaagaagata
aacagcaagttctga

DBGET integrated database retrieval system