KEGG   Takifugu rubripes (torafugu): 101072923Help
Entry
101072923         CDS       T02386                                 

Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2-like
Orthology
K05859  
phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101072923
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    101072923
   04370 VEGF signaling pathway
    101072923
   04020 Calcium signaling pathway
    101072923
   04070 Phosphatidylinositol signaling system
    101072923
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101072923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 1224 aa AA seqDB search
MAERGQQGEMTDYKKILIKRDLEMGAVMTVFRQKAERLTVQVIMETRQVAWTRTVDKTDG
VLDLFEIREIRPGRNSKDFERFKDGKDKHDDNACFTIFYGSQFVLNTLSLGVDSVAEAQK
WLTGLQLLWKETLEAPTPVLIESWLRKQMYSVNQTKTNSITVKELKALLPFLNYKAPSSR
TLKDKFQEVGSKKDRLDFEQFHKFYNHIMFEQNEVNILEEFKKESCAFILGNTDKPDASA
VMLHDFQRFLVYDQKESWAADLNQVRELMSIFIDDTMRKTNDPVFTVSEFLGYLFSEENS
IWDKKFSEISYIDMNNPLSHYWINSSHNTYLTGDQLRSESSTEAYVRALRLGCRCVELDC
WEGPGEPIIYHGWTRTTKIKFEDVVKAINDHAFVTSEFPVILSIEEHCPIEQQRQMARIF
REVFGDKLLTEPVEVIAEQLPSPTQLKGKIILKHKKLSVEGGGGGPIKDFRKGQKQGDLQ
IWDPVDRQWNKHYCVISDDKLYYAEEEEQEEEDTQKCTDLHSTEPWFHGHMNGGRQMAER
LIYEYCAETGGRDGTFLVRPSDRFALSYTLSFWRDGRVQHCRIRTASQEGRFYYYLTANL
HFPSLISLIQHYRENPLRCQDFELRLTDAVAQQNPHLHEGWFYSNLSRGEAEDYLIKIPR
DGAFLIRQREGEPDSFAITFKGDGQVKHCRIQKEGKRYLLGTTTDFESLVELVNYYRKKP
LYRKIKLRYTVTPELVERFSTSKSVVRALYSYQAARPDELSFSKGALIYNISKENGDWWK
GDYGGKVQHFFPANHVEEVSRITAPESSQQDLDDNPLGELCKGVIDISKCNILNLKNGKN
GKLHVLTLQDLEDDSLQFDLSAETLEELFKWYQAAWDITQRMISKEYNRQHEVEVEKKEE
VAMEMSDLVVYCQPRSKEKDRFDSYSYKEIRSFVENKVPGKSRTKEFLLYNRKALSRTYP
KGQRVESSNYDPYPLWAVGCHMVALNFQTADKYTQLNSALFSLNGCTGYVLQPEVMRSDS
FDPLQEKNKLQYIIDVRIIAARHLPRPGRSIASPFVEVELCGHTEEKFKTFVYRDNGLNP
VWKAPAEPITFRVYEAELTFLRFVVYEEDMFSDPNFLAQATFPVKGIRSGYRSVPLRNGY
SEKLELASLLVHVDARPAGRMEEDLYSSSSNLRKKSDVSSEPFLYDTHTNLQHHALPRQQ
NHLSREFSTNEKQRMKEKKINSKF
NT seq 3675 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacgggggcaacaaggggagatgaccgattacaagaagattctgatcaagcgg
gacttggagatgggtgcagtcatgacggtgttccgacagaaagcggagcggctcactgtg
caggtcatcatggagacccgacaggtggcttggacacgcactgtggacaagacagacggc
gtcttggacctgtttgagatccgagagatccgtcctggaaggaactccaaagactttgag
cgatttaaagatggcaaggacaaacatgatgacaacgcctgcttcacaattttctatggc
tcgcagtttgttctcaacacactcagcctcggggttgattctgtggctgaggcgcaaaaa
tggctgacaggactgcaactgttgtggaaagagacactggaggctcccactccagttctt
attgagagttggctaaggaagcagatgtactctgtcaatcagacaaagaccaacagcatc
accgtgaaggagttgaaggctctgcttcctttcctcaactataaggcccccagctctcga
acgctcaaagacaaatttcaggaagtggggtcaaagaaagatcgcctggatttcgagcag
tttcacaagttttacaatcatatcatgtttgaacagaatgaggtgaatattcttgaggag
ttcaaaaaggaatcgtgtgcgtttattctcggtaacactgataaacccgacgcttctgcc
gtcatgcttcatgatttccagagattcctcgtctatgatcaaaaggaaagctgggctgct
gatttgaaccaggtcagagaactgatgtccatcttcatcgacgacaccatgagaaaaacc
aacgaccccgtgttcaccgtcagtgagttcctcggttacctgttttcagaagagaacagt
atttgggacaaaaagttttctgagatcagctacatagacatgaacaaccctttatcccac
tactggatcaactcctcacacaacacatatctgactggagatcagcttcgtagtgaatca
tccacagaggcttacgtgcgagctctgcgtcttggatgccgctgtgtcgaattggactgc
tgggaaggacccggggagccaatcatttaccacggttggaccaggaccaccaaaatcaag
tttgaggatgtggtcaaagccattaacgatcatgcctttgttacatcagagtttccagtg
atcctgtccatcgaggagcattgccctatagagcagcagcgtcagatggctcggattttc
cgggaagtgtttggagacaagctgctgacggaacccgtggaggtgatagctgaacagctt
ccctcaccgacacagctgaaaggaaagatcatacttaagcacaagaagctgagcgtggag
ggaggaggaggaggacccattaaagacttcaggaaggggcagaaacagggagatctgcag
atctgggatcctgtggacaggcaatggaataaacactactgtgtgatctctgatgataag
ctgtattatgcagaggaagaagagcaagaggaagaggatactcagaagtgtacagacctg
cacagtacggagccctggtttcatggtcacatgaatgggggaaggcaaatggccgagcgg
ctgatctacgagtactgtgccgagacggggggacgggacgggaccttcttggtccggccc
agtgacagatttgctctaagctataccctgtccttctggcgtgacggacgggtccagcac
tgccgcattcgtacggcctcacaagagggacgcttttactattatctgacggcaaacctg
cactttcccagcttgatttccctgatccagcactacagagagaacccactacgctgccag
gattttgagctgcgtctcactgatgctgtagcacagcaaaacccacatctccacgaaggg
tggttctacagtaacttgagcagaggggaggcagaggattacctgataaagattcccaga
gacggagccttcctgattcggcagagagaaggagaaccggactcttttgccatcacgttc
aaaggcgatggtcaggttaagcactgccggatccagaaggaggggaagcgctacctgctg
ggcaccacgacagactttgagagcctggtggagctcgtcaactactacagaaagaagccg
ctgtatcggaagatcaagctacgttacaccgtcacgcccgagctcgtggagcgcttcagc
acatctaaaagtgtcgttcgagccctgtacagttaccaggccgcacggccggatgagctc
agcttcagtaagggagcgttgatctacaacatctccaaggagaacggcgactggtggaaa
ggtgactatggtggaaaagtgcagcatttctttccagccaatcacgtagaggaagtctcc
agaattacagctcctgagtccagtcagcaggacttggacgacaacccgctgggtgagctg
tgtaagggtgtcatagacatctccaaatgcaacattctaaacttgaagaacggcaaaaat
gggaagctccacgtgttgaccctgcaggacctggaggacgacagcctgcagtttgacctg
tctgctgagactctggaggagctgtttaaatggtaccaggctgcctgggacatcacccag
agaatgattagcaaggagtacaacaggcaacacgaggtggaagtggaaaagaaagaggag
gttgctatggagatgtcggacctggtggtctactgtcagccgcgcagcaaagagaaagac
cgctttgacagctacagctacaaagagatccgctccttcgtggaaaacaaggtgccggga
aagagccgcaccaaagaattcctgctgtacaaccgcaaagcgctgagccggacctatccc
aaaggtcagcgcgtggagtcctccaactatgacccgtacccactgtgggccgttggctgt
catatggtggcgctcaacttccagaccgcagataaatacacccagctgaacagcgccctc
ttcagtctgaatgggtgcacaggttacgtgctgcagccggaggtcatgcgctcggacagc
ttcgacccgctgcaggagaagaacaaactccagtacatcattgacgtcaggattattgct
gccagacacctccccaggcctggccgcagcatcgccagcccgtttgtggaggtggagctg
tgtggacacacggaggagaagtttaagacctttgtctatcgtgataatggtttgaaccca
gtgtggaaagccccggcagagcccataaccttcagagtgtacgaggccgagctcaccttc
ctgcgctttgtggtctacgaggaggacatgttctcagaccccaactttctggctcaggcc
acatttcctgttaaaggaatccgctcaggttaccgctccgttcctctgagaaacggctac
agcgaaaagttggagctagcctctctgctggttcacgtcgatgcgaggccagctgggaga
atggaggaggacttgtactcatcctctagcaacctgaggaagaagtcggatgtcagcagc
gagccgttcctgtacgacacgcacaccaacctccagcaccacgcccttccccgccagcag
aaccacctttcaagagagttcagcaccaacgagaagcagaggatgaaagaaaagaagata
aacagcaagttctga

DBGET integrated database retrieval system