KEGG   Takifugu rubripes (torafugu): 101072923Help
Entry
101072923         CDS       T02386                                 

Gene name
plcg2
Definition
(RefSeq) phospholipase C, gamma 2 (phosphatidylinositol-specific)
  KO
K05859  
phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Inositol phosphate metabolism
Metabolic pathways
ErbB signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
VEGF signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101072923 (plcg2)
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    101072923 (plcg2)
   04370 VEGF signaling pathway
    101072923 (plcg2)
   04020 Calcium signaling pathway
    101072923 (plcg2)
   04070 Phosphatidylinositol signaling system
    101072923 (plcg2)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101072923 (plcg2)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101072923 (plcg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
9
AA seq 1250 aa AA seqDB search
MAERGQQGEMTDYKKILIKRDLEMGAVMTVFRQKAERLTVQVIMETRQVAWTRTVDKTDG
VLDLFEIREIRPGRNSKDFERFKDGKDKHDDNACFTIFYGSQFVLNTLSLGVDSVAEAQK
WLTGLQLLWKETLEAPTPVLIESWLRKQMYSVNQTKTNSITVKELKALLPFLNYKAPSSR
TLKDKFQEVGSKKDRLDFEQFHKFYNHIMFEQNEILEEFKKESCAFILGNTDKPDASAVM
LHDFQRFLVYDQKESWAADLNQVRELMSIFIDDTMRKTNDPVFTVSEFLGYLFSEENSIW
DKKFSEISYIDMNNPLSHYWINSSHNTYLTGDQLRSESSTEAYVRALRLGCRCVELDCWE
GPGEPIIYHGWTRTTKIKFEDVVKAINDHAFVTSEFPVILSIEEHCPIEQQRQMARIFRE
VFGDKLLTEPVEVIAEQLPSPTQLKGKIILKHKKLSVEGGGGGPIKDFRKGQKQGDLQIW
DPVDRQWNKHYCVISDDKLYYAEEEEQEEEDTQKYQDLHSTEPWFHGHMNGGRQMAERLI
YEYCAETGGRDGTFLVRPSDRFALSYTLSFWRDGRVQHCRIRTASQEGRFYYYLTANLHF
PSLISLIQHYRENPLRCQDFELRLTDAVAQQNPHLHEGWFYSNLSRGEAEDYLIKIPRDG
AFLIRQREGEPDSFAITFKGDGQVKHCRIQKEGKRYLLGTTTDFESLVELVNYYRKKPLY
RKIKLRYTVTPELVERFSTVSYFSFVFLFLRIPPHLRLFSGLQSKSVVRALYSYQAARPD
ELSFSKGALIYNISKENGDWWKGDYGGKVQHFFPANHVEEVSRITAPESSQQDLDDNPLG
ELCKGVIDISKCNILNLKNGKNGKLHVLTLQDLEDDSLQFDLSAETLEELFKWYQAAWDI
TQRMISKEYNRQHEIRQQVEVEKKEEVAMEMSDLVVYCQPRSKEKDRFDSYSYKEIRSFV
ENKVPGKSRTKEFLLYNRKALSRTYPKGQRVESSNYDPYPLWAVGCHMVALNFQTADKYT
QLNSALFSLNGCTGYVLQPEVMRSDSFDPLQEKNKLQYIIDVRIIAARHLPRPGRSIASP
FVEVELCGHTEEKFKTFVYRDNGLNPVWKAPAEPITFRVYEAELTFLRFVVYEEDMFSDP
NFLAQATFPVKGIRSGYRSVPLRNGYSEKLELASLLVHVDARPAGRMEEDLYSSSSNLRK
KSDVSSEPFLYDTHTNLQHHALPRQQNHLSREFSTNEKQRMKEKKINSKF
NT seq 3753 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacgggggcaacaaggggagatgaccgattacaagaagattctgatcaagcgg
gacttggagatgggtgcagtcatgacggtgttccgacagaaagcggagcggctcactgtg
caggtcatcatggagacccgacaggtggcttggacacgcactgtggacaagacagacggc
gtcttggacctgtttgagatccgagagatccgtcctggaaggaactccaaagactttgag
cgatttaaagatggcaaggacaaacatgatgacaacgcctgcttcacaattttctatggc
tcgcagtttgttctcaacacactcagcctcggggttgattctgtggctgaggcgcaaaaa
tggctgacaggactgcaactgttgtggaaagagacactggaggctcccactccagttctt
attgagagttggctaaggaagcagatgtactctgtcaatcagacaaagaccaacagcatc
accgtgaaggagttgaaggctctgcttcctttcctcaactataaggcccccagctctcga
acgctcaaagacaaatttcaggaagtggggtcaaagaaagatcgcctggatttcgagcag
tttcacaagttttacaatcatatcatgtttgaacagaatgagattcttgaggagttcaaa
aaggaatcgtgtgcgtttattctcggtaacactgataaacccgacgcttctgccgtcatg
cttcatgatttccagagattcctcgtctatgatcaaaaggaaagctgggctgctgatttg
aaccaggtcagagaactgatgtccatcttcatcgacgacaccatgagaaaaaccaacgac
cccgtgttcaccgtcagtgagttcctcggttacctgttttcagaagagaacagtatttgg
gacaaaaagttttctgagatcagctacatagacatgaacaaccctttatcccactactgg
atcaactcctcacacaacacatatctgactggagatcagcttcgtagtgaatcatccaca
gaggcttacgtgcgagctctgcgtcttggatgccgctgtgtcgaattggactgctgggaa
ggacccggggagccaatcatttaccacggttggaccaggaccaccaaaatcaagtttgag
gatgtggtcaaagccattaacgatcatgcctttgttacatcagagtttccagtgatcctg
tccatcgaggagcattgccctatagagcagcagcgtcagatggctcggattttccgggaa
gtgtttggagacaagctgctgacggaacccgtggaggtgatagctgaacagcttccctca
ccgacacagctgaaaggaaagatcatacttaagcacaagaagctgagcgtggagggagga
ggaggaggacccattaaagacttcaggaaggggcagaaacagggagatctgcagatctgg
gatcctgtggacaggcaatggaataaacactactgtgtgatctctgatgataagctgtat
tatgcagaggaagaagagcaagaggaagaggatactcagaagtaccaggacctgcacagt
acggagccctggtttcatggtcacatgaatgggggaaggcaaatggccgagcggctgatc
tacgagtactgtgccgagacggggggacgggacgggaccttcttggtccggcccagtgac
agatttgctctaagctataccctgtccttctggcgtgacggacgggtccagcactgccgc
attcgtacggcctcacaagagggacgcttttactattatctgacggcaaacctgcacttt
cccagcttgatttccctgatccagcactacagagagaacccactacgctgccaggatttt
gagctgcgtctcactgatgctgtagcacagcaaaacccacatctccacgaagggtggttc
tacagtaacttgagcagaggggaggcagaggattacctgataaagattcccagagacgga
gccttcctgattcggcagagagaaggagaaccggactcttttgccatcacgttcaaaggc
gatggtcaggttaagcactgccggatccagaaggaggggaagcgctacctgctgggcacc
acgacagactttgagagcctggtggagctcgtcaactactacagaaagaagccgctgtat
cggaagatcaagctacgttacaccgtcacgcccgagctcgtggagcgcttcagcacagta
agttacttttcttttgtctttctttttttgcgaatccctcctcacctccgcttgttttct
ggcctccagtctaaaagtgtcgttcgagccctgtacagttaccaggccgcacggccggat
gagctcagcttcagtaagggagcgttgatctacaacatctccaaggagaacggcgactgg
tggaaaggtgactatggtggaaaagtgcagcatttctttccagccaatcacgtagaggaa
gtctccagaattacagctcctgagtccagtcagcaggacttggacgacaacccgctgggt
gagctgtgtaagggtgtcatagacatctccaaatgcaacattctaaacttgaagaacggc
aaaaatgggaagctccacgtgttgaccctgcaggacctggaggacgacagcctgcagttt
gacctgtctgctgagactctggaggagctgtttaaatggtaccaggctgcctgggacatc
acccagagaatgattagcaaggagtacaacaggcaacacgagatcagacagcaggtggaa
gtggaaaagaaagaggaggttgctatggagatgtcggacctggtggtctactgtcagccg
cgcagcaaagagaaagaccgctttgacagctacagctacaaagagatccgctccttcgtg
gaaaacaaggtgccgggaaagagccgcaccaaagaattcctgctgtacaaccgcaaagcg
ctgagccggacctatcccaaaggtcagcgcgtggagtcctccaactatgacccgtaccca
ctgtgggccgttggctgtcatatggtggcgctcaacttccagaccgcagataaatacacc
cagctgaacagcgccctcttcagtctgaatgggtgcacaggttacgtgctgcagccggag
gtcatgcgctcggacagcttcgacccgctgcaggagaagaacaaactccagtacatcatt
gacgtcaggattattgctgccagacacctccccaggcctggccgcagcatcgccagcccg
tttgtggaggtggagctgtgtggacacacggaggagaagtttaagacctttgtctatcgt
gataatggtttgaacccagtgtggaaagccccggcagagcccataaccttcagagtgtac
gaggccgagctcaccttcctgcgctttgtggtctacgaggaggacatgttctcagacccc
aactttctggctcaggccacatttcctgttaaaggaatccgctcaggttaccgctccgtt
cctctgagaaacggctacagcgaaaagttggagctagcctctctgctggttcacgtcgat
gcgaggccagctgggagaatggaggaggacttgtactcatcctctagcaacctgaggaag
aagtcggatgtcagcagcgagccgttcctgtacgacacgcacaccaacctccagcaccac
gcccttccccgccagcagaaccacctttcaagagagttcagcaccaacgagaagcagagg
atgaaagaaaagaagataaacagcaagttctga

DBGET integrated database retrieval system