KEGG   Takifugu rubripes (torafugu): 101072960Help
Entry
101072960         CDS       T02386                                 

Gene name
gba2
Definition
(RefSeq) glucosidase, beta (bile acid) 2
  KO
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    101072960 (gba2)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    101072960 (gba2)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     101072960 (gba2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 848 aa AA seqDB search
MTAEWGEKCTADLMSRYVSKEMGHGVPGEGWRICLAHEFKEKRKPFQSGDVSLSQVWEHL
GLGIRYLYWWYKKTRVEKKAPFIDIFGAVPLRQIYGAPLGGIGGGTITRGWRGEFCRWQL
KPGMYHYKTVIENQFMVCLRRNGQTVYQQVLSVERPPTLQGWNWGFCGEYAYYHALYPRA
WNVYHLPGQNVTLTCRQISPIIPHDYQDASLPVAVFVWDIENKNDYALDVSIMFTLLNGS
GHADDKSGGHWNEPFRLEKNGEAVSGVLLHHCTAVNPYTLCIAAREQPKREVTHQTAFSP
KGTCHGLWSDLITDGRLDSPTGSSPPTAKGERVAAALAAGCSVATQSRGSLEFCLAWDMP
KITFGSGEKEHSRRYTRYYGSKGDACPLLSHHALTHYRGWEKSIEEWQGPILQDSSLPTW
YKSALFNELYFVADGGTVWTELAEDADVSGGLRSEEGGLPAQPSVIKDYGRFAYLEGQEY
RMYNTYDVHYYASFALIMLWPKLALSLQYDIAGSVVQQDPTERLYLMNGRCSPVKTKGVV
PHDIGDPEDEPWQRVNAYLIHNTADWKDLNLKFVLQVYRDFHLTQDSQYLQDMWPICQTV
MESALKFDLDGDGLIENSGFADQTYDGWTVTGPSAYCGGLWLASLVVMCKMARLLENEMK
YQYYRDILDRGSVAYDKVLWNGKYYNYDSSGKDHSNSVMSDQCAGHWFLRASGLGDGEYQ
AFPKEKIQRALKTVFDLNVMSFAGGQMGAVNGMRPEGVPDRSSVQSDEVWIGVVYGLAAT
MIHEGMLEEGMRTAEGCYRTVWERLGMAFQTPEAYCEKGIYRSLAYMRPLSIWAMQLALD
ASRNKHSS
NT seq 2547 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagagtggggtgaaaaatgcacagctgacctcatgagcaggtatgtctctaag
gaaatgggccacggagtccctggagagggttggcgtatctgcctcgcacacgaattcaag
gagaagaggaagccttttcaatcgggagatgtctcactgtcccaagtttgggaacatcta
ggccttggaatcaggtatctatattggtggtacaagaagactcgggttgaaaaaaaggct
ccattcattgatatatttggagccgtacccttacgtcaaatatatggtgctccactggga
gggattggaggaggaaccatcacaagagggtggaggggggaattctgcagatggcagctc
aaacccgggatgtaccactacaaaacggttatcgaaaatcagtttatggtgtgtttgcgg
cgcaacgggcagacggtttaccagcaggtgctctctgtggagcgtccccccacattacaa
ggctggaactggggcttctgtggcgagtatgcctactatcacgcattgtacccccgtgcc
tggaatgtgtaccacctgcccggacagaacgtcactttaacctgcagacagatctcaccc
atcatccctcatgactaccaagatgccagtttacctgtggcagtattcgtgtgggatata
gagaacaagaatgattatgccctggacgtctccatcatgttcacgctgctcaacgggtca
ggacacgcagatgacaagagcggggggcactggaacgaaccattccgcctggagaagaat
ggagaggcagtgtcaggagtcttgctccatcactgcactgccgtgaacccttacactttg
tgcatcgcagcccgagaacagcccaagcgggaagttacacaccagacagccttcagccca
aaggggacctgtcatggcctgtggagtgacctcatcactgacggacggctggactctcct
acgggatccagcccgccgacagctaaaggagaaagggtggcagcagctttggctgcgggc
tgctcggtggccacccagagccgcggctcgttggagttctgcctggcctgggacatgcct
aaaatcacctttggctctggggaaaaagagcacagcaggagatacacgcgctattatggc
agcaaaggagatgcctgccccctgctgagccaccacgccttaacgcactacagaggttgg
gaaaagagcatagaggagtggcagggacccattttacaggacagctcgctgcccacctgg
tataagtcggccctcttcaatgaactgtacttcgttgctgatggagggacggtgtggacg
gagctagcggaggatgccgatgtcagtggaggactgcgctccgaggaagggggtctgcca
gcacagcccagtgtcatcaaggattatggccgttttgcctatctagagggccaggagtac
cgaatgtacaacacgtatgacgtgcactactatgcctcttttgccctcatcatgctgtgg
cccaaacttgctctcagtctgcagtatgatatcgctggcagcgtggttcagcaagacccg
acagagaggctctatctgatgaacggccggtgttctcctgtcaagactaaaggtgtggtg
ccccatgacatcggtgacccagaggatgagccgtggcagagggtaaacgcgtacctcatc
cacaacactgcagactggaaagacctgaacctgaagtttgtcctgcaagtgtacagagac
tttcatctcacccaggacagtcagtacctccaggacatgtggcccatctgccagacggtg
atggagtcggcgctaaaatttgacctggatggcgatgggctgatagagaactctggattt
gccgaccagacctatgatggttggacggtgacggggccgagtgcgtactgtggtgggctg
tggttggcgtccctggttgtcatgtgcaaaatggccagacttttggaaaatgaaatgaaa
taccagtattacagagacatattagacagggggagcgttgcctatgacaaagtgctatgg
aacggcaagtactacaactatgatagcagtggaaaagaccattccaatagtgtcatgtct
gaccagtgtgctggccactggtttctgcgagcatccggtttgggagacggcgaataccag
gcctttccaaaagagaagatccagagggcgcttaaaaccgtatttgacttgaatgtaatg
agttttgctggaggccaaatgggggctgttaatggcatgcgccctgagggagtgcccgat
cgctccagtgtccagtcagatgaagtctggattggggtcgtgtacggactggcagccaca
atgatccatgaggggatgctggaggaggggatgcgaacagctgaaggttgttaccggact
gtatgggagcgactggggatggccttccagacccctgaagcctactgcgaaaaaggcatc
taccgttctttggcgtacatgaggcctctgagcatctgggccatgcagctagcgctggat
gcttcaaggaataaacactccagttaa

DBGET integrated database retrieval system