KEGG   Takifugu rubripes (torafugu): 101073021Help
Entry
101073021         CDS       T02386                                 

Definition
thymidine phosphorylase-like
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    101073021
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    101073021
Enzymes [BR:tru01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     101073021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 448 aa AA seqDB search
MLTIPDLIKGKRDGRVLSDEEIRTFVRMVTNKSIQEAQIGAMLMAIWQKGMIDSEIQTLT
REMMSSGEVMSWPKSWEGLVVDKHSTGGVGDKVSLVLVPALAVCGCKVPMISGRGLAHTG
GTLDKMESIPGFNINQSASQILEILSSVGCCIVGQTESLVPADRVLYALRDATSTVDSLP
LIAGSIISKKGAESLSALVLDVKFGQAALYKDLKGAKELAHLLVKVGNGLGIRTGAVLSS
MNSMIGRCVGNSLEAMESLETLKGRGPDDLMELVNTLGGVLLLMTGLVPDLSEGRKQIHE
AVTGGAALSRFQAMLEAQGVAREAAMQLCSAHTDYFKVLRKSEHQLELQSGADGTVLDIN
GLVIAEVLHNLGAGRTKAGQAINHSVGAELLVSVGQRVAKGDSWLRLHHEDAALPPDLIS
RLQNAVMLGNADTGVRPKLIEELLLPRS
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctaacgatcccagatctgatcaaaggcaagcgtgacggacgagtcctgagtgatgaa
gagatcaggaccttcgtccggatggtgaccaacaagtccatccaggaggcacaaatcgga
gccatgctcatggccatctggcagaagggaatgattgacagcgagatccagaccctgacc
agggagatgatgtcatcaggggaagtgatgtcatggccaaagagctgggaggggctggtg
gttgacaaacactcgactggaggggtcggggataaggtcagcctggtgctggtgccagcg
ctcgctgtgtgtgggtgtaaggtgccaatgatcagtggtcggggcttggctcatacggga
ggaactctggacaaaatggaatcgattccaggattcaacatcaaccaatctgcttctcag
attctggagatcctgagttctgtgggctgctgcattgtgggtcagactgaaagtctggtt
cctgcagatcgggtcctctatgctctgcgagatgccaccagtactgtggacagcctgcca
ctgattgctggttctattatctcaaagaaaggtgctgagtcactctctgctctcgtgctg
gacgtcaagtttggacaagctgctctgtataaagacctgaagggcgctaaagagttagct
catctgctggtgaaagtcggaaatggtctggggatacgaacgggggcggtactcagcagt
atgaacagtatgattggtcgatgtgttggaaacagtctggaggcgatggagtctctagag
acgctaaagggccgaggacctgacgacctgatggagctggtcaacactctgggtggagtc
ctgctactgatgactgggttggttcctgacctgtcagagggcaggaagcagattcatgag
gcggtgacaggtggagctgccctgtccaggttccaggctatgctggaagctcagggcgtg
gccagagaggcggccatgcagctttgctccgcccacactgattacttcaaggtcctgagg
aaatctgagcatcagctggagctgcagtctggagcagatggaacggttctggacatcaac
ggtttagttatagctgaggttcttcataacctgggggcaggccgaacgaaggctggacaa
gctatcaatcacagcgtgggggcagagttgctggtgtctgtcggccagcgggtggctaaa
ggcgattcttggttgaggctccatcatgaggacgcagccctgcccccagacctaatcagc
cgattacagaatgcagtgatgcttggaaacgctgacacaggtgtacggcccaaattgatt
gaagaacttctgctacctcgttcttaa

DBGET integrated database retrieval system