KEGG   Takifugu rubripes (torafugu): 101073102Help
Entry
101073102         CDS       T02386                                 

Gene name
plcb3
Definition
(RefSeq) phospholipase C beta 3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00562  Inositol phosphate metabolism
tru01100  Metabolic pathways
tru04020  Calcium signaling pathway
tru04070  Phosphatidylinositol signaling system
tru04261  Adrenergic signaling in cardiomyocytes
tru04270  Vascular smooth muscle contraction
tru04310  Wnt signaling pathway
tru04371  Apelin signaling pathway
tru04540  Gap junction
tru04621  NOD-like receptor signaling pathway
tru04912  GnRH signaling pathway
tru04916  Melanogenesis
tru04933  AGE-RAGE signaling pathway in diabetic complications
Module
tru_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101073102 (plcb3)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101073102 (plcb3)
   04371 Apelin signaling pathway
    101073102 (plcb3)
   04020 Calcium signaling pathway
    101073102 (plcb3)
   04070 Phosphatidylinositol signaling system
    101073102 (plcb3)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    101073102 (plcb3)
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    101073102 (plcb3)
  Endocrine system
   04912 GnRH signaling pathway
    101073102 (plcb3)
   04916 Melanogenesis
    101073102 (plcb3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101073102 (plcb3)
   04270 Vascular smooth muscle contraction
    101073102 (plcb3)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101073102 (plcb3)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101073102 (plcb3)
Membrane trafficking [BR:tru04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101073102 (plcb3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101073102 (plcb3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PLC-beta_C PI-PLC-Y DUF1154 EF-hand_like
Motif
Other DBs
NCBI-GeneID: 101073102
NCBI-ProteinID: XP_003977980
Position
Un
AA seq 1252 aa AA seqDB search
MAGAKPGVHALQLKPVSVHDALKKGGKFIRWDEEPNSGPPTLVTLKVDPDGFFLYWTGGS
NLEVEILDMNTIRDTRTGKYAKQPKDPKVREVLGFGKGNNVEGKLVTIVHGNDLVNISFL
NFQAMQEDTAKIWTDELFTLATNILSQNVSRNTFLLKAYTKLKLQVNQDGKIVVKNVLKL
FSDKKRVETALEQCGLINNKSEGIKPDDFTWEAFLKFLDNLCLRPEIQSIFEESGSKRKP
FISLDQFMEFLNRRQRDSRLNEVLYPPLKREQVRQIMEKYETNTSQLERDQISLQAFARY
LGGEENGIVPPERLDVIDDMNQPLSHYFINSSHNTYLTVGQLTGLSSVEMYRQVLLTGCR
CVELDCWKGRPQDEEPYITHGFTMTTEIPFKEVIEAIAESAFKTSPYPVILSFENHVDSA
KQQAKMAEYCRTIFGDALVIDPLEKYPLEPGQPLPSPQELLGKILVKNKKKHRYHRPSNG
GSIRRREQGEQSSPNNDCPLNDGDSGLLLSNGEEKLAERLIKDLEPRKSIGGRERGGGED
ESALELKKPNPDEGTASSEVNATEEMSTLVNYIEPVKFKSFEVANKRRKFFEMSSFVETK
GMDILKGSPIEFVEYNKNQLSRIYPKGTRVDSSNYMPQLFWNVGCQMVALNFQTLDLPMQ
LNMGVFEYNGGSGYLLKPEFMRRTDKHFDPFTENIVDGIVANTVKIKVISGQFLMDKKVG
VYVEVDIFGLPADTKRKYRTKTSNGNSLDPVWDDEMFVFNKVVLPTMASLRIAVFEENGK
FIGHRILPVSAIRPGFHYINLKNELNQPLLLPSLLVYTEAQDYIPNEHQEYAEALTNPIK
HISQLHKRETQLAVLLEDNSEHVPDQPKDGEAGKESEVVPGGHSPSHVFPLNALDDAPDI
LKLPSSDKSQKCDLIATVLAEVQTQSIEELKQQKNYVKLLKKQSKELKELRKKHLKKVWN
LSKEQKSRSSQIQSDSQRRRSQMEKNLKRSIKRNEPHEPVQRELTALDREIEKQTVQLRE
WQMQELLKLRQQLHKLEKEMQEAHLQEAFQKLKETAHECQAAQLKRLRETCEREKKELQK
LLDRKRQNSITEAKSRDKDKAEVELNEINRKHIQDSVALIRKLEEAQTRRQEKLVLRQRE
VLQHIDEELPLLQAQLERALDEEHQRLPEEICQHLQLELENKGLRWDALFSPLSSNSSPS
SGPPSNCSTPSYPSTPRRTGWNTDNSQHSNTSLADSTSSSATILSESETSFG
NT seq 3759 nt NT seq  +upstreamnt  +downstreamnt
atggccggggccaagccgggcgtccacgcgctgcagctcaaacccgtgtccgtccacgac
gcgctgaagaaagggggcaagttcatcagatgggacgaggaaccaaacagcggaccgcct
accctggtgaccctgaaagtcgacccagatggattcttcctctactggaccggcgggtca
aacctggaggtggagatcctggacatgaacaccatcagggacaccagaaccggaaaatac
gccaaacaaccgaaggacccaaaggtgcgggaggtgctgggctttggtaagggcaacaat
gtggaagggaagctggtgaccatcgtgcacggcaatgacctggtcaacatttccttcctc
aacttccaggcaatgcaagaagacacggccaagatctggaccgatgagctcttcactctg
gccaccaacattctttcccagaatgtatcacggaacactttcctccttaaagcgtacacg
aagctgaagctgcaggtgaaccaggatgggaagatcgttgtgaagaacgtcctcaagctg
ttttcggataagaagcgagtggaaacggccctggagcaatgcggcctcattaacaacaag
tcagagggaatcaaaccagatgattttacctgggaggccttcctgaaattcctggacaac
ctctgtctccggcctgagatccaaagcatctttgaggaaagcggctccaagaggaagcca
ttcatctccctggaccagttcatggaattcctcaaccgcaggcagcgagactccaggctg
aacgaggtgctctaccccccgctgaaaagggagcaggtccgacagatcatggagaaatac
gagaccaacactagccagctggaaagagaccagatcagtttgcaagcattcgctcgctac
ctggggggcgaggagaacggcatcgtacccccagagaggctggacgtcatcgacgacatg
aaccagccgctatctcactacttcatcaactcctcgcacaacacgtacctcacagtgggc
cagctcactggcctgtcgtcggtggagatgtaccggcaggttctgctgaccggttgccgc
tgcgtggagcttgactgctggaagggccggccgcaagacgaggagccctacatcacccac
gggttcaccatgacgaccgagatccccttcaaggaagtgattgaggccatcgcagagagc
gctttcaagacctcgccgtaccccgtcatcctgtccttcgagaaccacgttgattcggcc
aaacaacaggccaaaatggctgaatactgcaggaccatcttcggagacgctctggtcatt
gatccactggagaaatatccgctggagcctgggcagccgctgccgtcgccccaggagctg
ctagggaagatcctcgtcaaaaacaaaaagaagcaccgctaccaccggccctccaacggc
ggcagcatacggcggcgggagcagggggagcagtcgtcgcccaacaacgactgccccctg
aatgatggcgacagcggtctgcttctgtccaacggcgaggagaaactggccgagaggctg
atcaaagacttggagccccgcaaatccataggtgggagagagcgaggaggaggagaagac
gagtctgccctggagctgaaaaagcccaacccggatgaggggacggccagcagcgaggtc
aacgccacggaggagatgtccaccctcgtcaactacatcgagccggtcaaattcaagagc
ttcgaggtggccaacaagaggaggaagttctttgagatgtcgtcattcgtggaaaccaaa
ggaatggacatcctcaagggctcgcccatcgagtttgtagagtacaataaaaaccagctg
agccgaatctaccctaaaggcacgagggtggacagctccaactacatgcctcagctcttc
tggaacgtcggatgccagatggtggcgctaaacttccagacgctcgacctcccgatgcag
ctgaacatgggcgtgttcgagtacaacgggggaagcggctacctgctgaaacccgagttc
atgaggagaacggacaaacacttcgaccctttcacggaaaacatcgtggatgggatcgtc
gccaacaccgtcaagataaaagtgatctcaggccagttcttgatggacaaaaaagtgggc
gtgtacgtggaggtggacatatttggacttcccgctgacacaaagaggaagtacaggacc
aaaacgtccaacgggaactccctggacccagtttgggacgatgaaatgtttgtctttaat
aaggtggttctccctacgatggcctcactgaggatagctgtctttgaggaaaacggcaag
ttcatagggcaccggatcctcccggtatcggccatcagacccggcttccactacatcaac
ctgaagaatgagctgaaccagcctctcctgctgccctcgctgcttgtgtacaccgaagct
caggactacatccccaatgaacaccaggagtacgcggaagcgctcaccaaccccatcaag
cacatcagtcaactgcacaagcgagagacgcagctggcggttctcctggaggacaacagc
gagcacgtccccgaccagccgaaagacggagaggccgggaaagagagcgaggtggtgcca
ggaggccactccccctcccatgtcttcccgctcaacgcgctggacgacgcccctgatatc
ctcaagttaccctcatcagacaaaagccagaaatgcgacctcatagccacagttttggca
gaggtccagacccagtccatagaggagctgaagcagcagaagaactacgtgaagctgctg
aagaaacagagcaaagagctgaaagagctgcgcaagaagcacctgaagaaggtgtggaac
ctgagtaaagagcagaagagtcgcagcagccagatccagtcggactcccagaggaggcgc
agccagatggagaagaacctcaaacgcagcatcaagagaaacgagccccacgagccggtg
cagcgcgagctgacggcgctggaccgggagattgagaagcagacggtccagctgagggag
tggcagatgcaggagctgctgaagctccggcagcagctccacaagctggagaaggagatg
caggaagcccacctgcaggaggccttccagaagctgaaggaaaccgcgcacgaatgccaa
gcggcgcagctgaagaggctccgggaaacgtgcgagagggagaagaaggagctgcagaag
ctcctggacaggaagcggcagaacagcatcaccgaggccaaaagccgcgacaaagacaaa
gctgaagtggagctgaacgagatcaacaggaaacacattcaggattcggtcgccttaatc
cgcaagctggaggaggctcagaccaggaggcaggagaagctggtcctgaggcagcgggag
gtgctgcagcacatagacgaggagctcccgctgctccaggctcagctggaacgggccctg
gacgaggagcaccagcgactcccggaggagatctgccagcaccttcagctggagctggag
aacaaaggcctccgctgggacgccctgttctccccgctgtccagcaacagcagccccagc
tccggcccgccctccaactgctccacgccgtcgtacccgtccacgccacgccggaccggc
tggaacacagacaatagccaacacagcaacacctcgttggccgactccacgtcctcgtcc
gccaccatcctgtcggagtcggagacgtcgttcggctga

DBGET integrated database retrieval system