KEGG   Takifugu rubripes (torafugu): 101073102Help
Entry
101073102         CDS       T02386                                 

Definition
1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3-like
Orthology
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
GnRH signaling pathway
Melanogenesis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101073102
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101073102
   04020 Calcium signaling pathway
    101073102
   04070 Phosphatidylinositol signaling system
    101073102
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    101073102
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    101073102
   04916 Melanogenesis
    101073102
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101073102
   04270 Vascular smooth muscle contraction
    101073102
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101073102
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1252 aa AA seqDB search
MAGAKPGVHALQLKPVSVHDALKKGGKFIRWDEEPNSGPPTLVTLKVDPDGFFLYWTGGS
NLEVEILDMNTIRDTRTGKYAKQPKDPKVREVLGFGKGNNVEGKLVTIVHGNDLVNISFL
NFQAMQEDTAKIWTDELFTLATNILSQNVSRNTFLLKAYTKLKLQVNQDGKIVVKNVLKL
FSDKKRVETALEQCGLINNKSEGIKPDDFTWEAFLKFLDNLCLRPEIQSIFEESGSKRKP
FISLDQFMEFLNRRQRDSRLNEVLYPPLKREQVRQIMEKYETNTSQLERDQISLQAFARY
LGGEENGIVPPERLDVIDDMNQPLSHYFINSSHNTYLTVGQLTGLSSVEMYRQVLLTGCR
CVELDCWKGRPQDEEPYITHGFTMTTEIPFKEVIEAIAESAFKTSPYPVILSFENHVDSA
KQQAKMAEYCRTIFGDALVIDPLEKYPLEPGQPLPSPQELLGKILVKNKKKHRYHRPSNG
GSIRRREQGEQSSPNNDCPLNDGDSGLLLSNGEEKLAERLIKDLEPRKSIGGRERGGGED
ESALELKKPNPDEGTASSEVNATEEMSTLVNYIEPVKFKSFEVANKRRKFFEMSSFVETK
GMDILKGSPIEFVEYNKNQLSRIYPKGTRVDSSNYMPQLFWNVGCQMVALNFQTLDLPMQ
LNMGVFEYNGGSGYLLKPEFMRRTDKHFDPFTENIVDGIVANTVKIKVISGQFLMDKKVG
VYVEVDIFGLPADTKRKYRTKTSNGNSLDPVWDDEMFVFNKVVLPTMASLRIAVFEENGK
FIGHRILPVSAIRPGFHYINLKNELNQPLLLPSLLVYTEAQDYIPNEHQEYAEALTNPIK
HISQLHKRETQLAVLLEDNSEHVPDQPKDGEAGKESEVVPGGHSPSHVFPLNALDDAPDI
LKLPSSDKSQKCDLIATVLAEVQTQSIEELKQQKNYVKLLKKQSKELKELRKKHLKKVWN
LSKEQKSRSSQIQSDSQRRRSQMEKNLKRSIKRNEPHEPVQRELTALDREIEKQTVQLRE
WQMQELLKLRQQLHKLEKEMQEAHLQEAFQKLKETAHECQAAQLKRLRETCEREKKELQK
LLDRKRQNSITEAKSRDKDKAEVELNEINRKHIQDSVALIRKLEEAQTRRQEKLVLRQRE
VLQHIDEELPLLQAQLERALDEEHQRLPEEICQHLQLELENKGLRWDALFSPLSSNSSPS
SGPPSNCSTPSYPSTPRRTGWNTDNSQHSNTSLADSTSSSATILSESETSFG
NT seq 3759 nt NT seq  +upstreamnt  +downstreamnt
atggccggggccaagccgggcgtccacgcgctgcagctcaaacccgtgtccgtccacgac
gcgctgaagaaagggggcaagttcatcagatgggacgaggaaccaaacagcggaccgcct
accctggtgaccctgaaagtcgacccagatggattcttcctctactggaccggcgggtca
aacctggaggtggagatcctggacatgaacaccatcagggacaccagaaccggaaaatac
gccaaacaaccgaaggacccaaaggtgcgggaggtgctgggctttggtaagggcaacaat
gtggaagggaagctggtgaccatcgtgcacggcaatgacctggtcaacatttccttcctc
aacttccaggcaatgcaagaagacacggccaagatctggaccgatgagctcttcactctg
gccaccaacattctttcccagaatgtatcacggaacactttcctccttaaagcgtacacg
aagctgaagctgcaggtgaaccaggatgggaagatcgttgtgaagaacgtcctcaagctg
ttttcggataagaagcgagtggaaacggccctggagcaatgcggcctcattaacaacaag
tcagagggaatcaaaccagatgattttacctgggaggccttcctgaaattcctggacaac
ctctgtctccggcctgagatccaaagcatctttgaggaaagcggctccaagaggaagcca
ttcatctccctggaccagttcatggaattcctcaaccgcaggcagcgagactccaggctg
aacgaggtgctctaccccccgctgaaaagggagcaggtccgacagatcatggagaaatac
gagaccaacactagccagctggaaagagaccagatcagtttgcaagcattcgctcgctac
ctggggggcgaggagaacggcatcgtacccccagagaggctggacgtcatcgacgacatg
aaccagccgctatctcactacttcatcaactcctcgcacaacacgtacctcacagtgggc
cagctcactggcctgtcgtcggtggagatgtaccggcaggttctgctgaccggttgccgc
tgcgtggagcttgactgctggaagggccggccgcaagacgaggagccctacatcacccac
gggttcaccatgacgaccgagatccccttcaaggaagtgattgaggccatcgcagagagc
gctttcaagacctcgccgtaccccgtcatcctgtccttcgagaaccacgttgattcggcc
aaacaacaggccaaaatggctgaatactgcaggaccatcttcggagacgctctggtcatt
gatccactggagaaatatccgctggagcctgggcagccgctgccgtcgccccaggagctg
ctagggaagatcctcgtcaaaaacaaaaagaagcaccgctaccaccggccctccaacggc
ggcagcatacggcggcgggagcagggggagcagtcgtcgcccaacaacgactgccccctg
aatgatggcgacagcggtctgcttctgtccaacggcgaggagaaactggccgagaggctg
atcaaagacttggagccccgcaaatccataggtgggagagagcgaggaggaggagaagac
gagtctgccctggagctgaaaaagcccaacccggatgaggggacggccagcagcgaggtc
aacgccacggaggagatgtccaccctcgtcaactacatcgagccggtcaaattcaagagc
ttcgaggtggccaacaagaggaggaagttctttgagatgtcgtcattcgtggaaaccaaa
ggaatggacatcctcaagggctcgcccatcgagtttgtagagtacaataaaaaccagctg
agccgaatctaccctaaaggcacgagggtggacagctccaactacatgcctcagctcttc
tggaacgtcggatgccagatggtggcgctaaacttccagacgctcgacctcccgatgcag
ctgaacatgggcgtgttcgagtacaacgggggaagcggctacctgctgaaacccgagttc
atgaggagaacggacaaacacttcgaccctttcacggaaaacatcgtggatgggatcgtc
gccaacaccgtcaagataaaagtgatctcaggccagttcttgatggacaaaaaagtgggc
gtgtacgtggaggtggacatatttggacttcccgctgacacaaagaggaagtacaggacc
aaaacgtccaacgggaactccctggacccagtttgggacgatgaaatgtttgtctttaat
aaggtggttctccctacgatggcctcactgaggatagctgtctttgaggaaaacggcaag
ttcatagggcaccggatcctcccggtatcggccatcagacccggcttccactacatcaac
ctgaagaatgagctgaaccagcctctcctgctgccctcgctgcttgtgtacaccgaagct
caggactacatccccaatgaacaccaggagtacgcggaagcgctcaccaaccccatcaag
cacatcagtcaactgcacaagcgagagacgcagctggcggttctcctggaggacaacagc
gagcacgtccccgaccagccgaaagacggagaggccgggaaagagagcgaggtggtgcca
ggaggccactccccctcccatgtcttcccgctcaacgcgctggacgacgcccctgatatc
ctcaagttaccctcatcagacaaaagccagaaatgcgacctcatagccacagttttggca
gaggtccagacccagtccatagaggagctgaagcagcagaagaactacgtgaagctgctg
aagaaacagagcaaagagctgaaagagctgcgcaagaagcacctgaagaaggtgtggaac
ctgagtaaagagcagaagagtcgcagcagccagatccagtcggactcccagaggaggcgc
agccagatggagaagaacctcaaacgcagcatcaagagaaacgagccccacgagccggtg
cagcgcgagctgacggcgctggaccgggagattgagaagcagacggtccagctgagggag
tggcagatgcaggagctgctgaagctccggcagcagctccacaagctggagaaggagatg
caggaagcccacctgcaggaggccttccagaagctgaaggaaaccgcgcacgaatgccaa
gcggcgcagctgaagaggctccgggaaacgtgcgagagggagaagaaggagctgcagaag
ctcctggacaggaagcggcagaacagcatcaccgaggccaaaagccgcgacaaagacaaa
gctgaagtggagctgaacgagatcaacaggaaacacattcaggattcggtcgccttaatc
cgcaagctggaggaggctcagaccaggaggcaggagaagctggtcctgaggcagcgggag
gtgctgcagcacatagacgaggagctcccgctgctccaggctcagctggaacgggccctg
gacgaggagcaccagcgactcccggaggagatctgccagcaccttcagctggagctggag
aacaaaggcctccgctgggacgccctgttctccccgctgtccagcaacagcagccccagc
tccggcccgccctccaactgctccacgccgtcgtacccgtccacgccacgccggaccggc
tggaacacagacaatagccaacacagcaacacctcgttggccgactccacgtcctcgtcc
gccaccatcctgtcggagtcggagacgtcgttcggctga

DBGET integrated database retrieval system