KEGG   Takifugu rubripes (torafugu): 101073214Help
Entry
101073214         CDS       T02386                                 

Gene name
ttk
Definition
(RefSeq) TTK protein kinase
  KO
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Cell cycle
Brite
KEGG Orthology (KO) [BR:tru00001]
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101073214 (ttk)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     101073214 (ttk)
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: Other group
  TTK family
   101073214 (ttk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 995 aa AA seqDB search
MEEEEHTDRKQQLAMLYQKLNKIKKSLHEDDTDNINQVISSNSPESCRSYLMDLEKKGDP
YTDGSHLTRLVDSYTRVFSNMPLCKHCENESYARMLVRFAELKVIQDVNEAEANFKVARS
HCQNFAFVHIAHAQFEHSQGNTKRAIYILQNALELGAKPKEILETALQSMQGGKSHICSE
DKENIQMTSNSNVHDSVKKGSVFQKVSRTSDGTGDLQLYSIFNSGSETYTGSSDDQLPGW
KSGSQRKRVVGIPGRVPIVPFSIPENNDDQDDGYISVKNSKRSDASIHNSLSRQTSASSI
TQGLGLSSSKRDPPDTDLHPQVINPDYCPWEDQAPADSTTTLLHTRDPSKLDDVTGNFDL
VVKTNSPESCWAYLTNLERRGNPHTDINLLNKLKDCYSKVFSKLQIQQFSKNVSYAKILV
RYAELRGIEDPDEAQDHFIVARSNCKGFAFVHIAHAQFEVSQGNVIKATSILHKAQAMNA
KPAQLLEMAICNLKTGAKQLVPSRDEEKEPSSGLPVTFPTAGGNQEVHVPARIPVNWPVE
QPKGPNREPLSEWKIPTFVSRHVSPEEKRITPPEPGPISRVPELIPIPSRQLLQSVCQTP
NTSSIHNANSFVTPVVKRAPEVPFSAVAPHRTGPAQHPFTPISQTPSFQTPQSSLTSISN
ESITIKGKQFFVLKMIGRGGSSKVYQVLGHKNQLFAVKYVDLEEADAQTIESYKNEIEHL
NHLQQYSDQIIKLYDYEITNSYIYMLMECGNLDLNTWLRNRKTVNPLERKFYWNNMLEAV
QTIHNHGIVHSDLKPANFVIVNASLKLIDFGIANRIQPDVTSIMKDSQVGTLNYMPPEAI
KDTSSKPGKARSKISPKGDVWSLGCILYCMTYGKTPFQSITNQIAKLQAIIDPSHKIDFP
DIPEKDLLDVLKRCLIRNPRERICIAELLEHPYLQLKPQMSPQRVPPCNGDLKKILTDLA
VLHSPNSIVRAANSLAKMCSSGHRLDVAECAKPSS
NT seq 2988 nt NT seq  +upstreamnt  +downstreamnt
atggaggaagaggagcatactgatagaaaacagcagcttgccatgctttatcaaaagctg
aacaaaattaaaaagtctttgcatgaagatgacacggacaatattaaccaggttatcagc
tccaactcacccgaatcatgccgctcatatttgatggacctggagaagaagggggacccc
tacacagacggtagtcatctcaccaggctggttgactcttacaccagagtattctccaat
atgccactgtgcaaacattgtgagaatgagagctatgccaggatgttggttcgatttgca
gagcttaaagtaattcaagacgtcaatgaagctgaagccaacttcaaagttgcgagatcc
cattgtcagaactttgcatttgtccacattgcacatgcacagtttgaacattcacaaggc
aacacaaagagagccatttacatcttgcaaaacgctcttgaactgggtgcaaaaccaaag
gaaatccttgaaacggctttgcagagtatgcaaggtggaaaatcgcacatctgttcagag
gataaggaaaatatacaaatgacttcgaacagtaacgtgcatgactccgtcaagaaaggc
tctgtattccagaaagttagcagaacttctgatgggactggtgacttgcagctctacagt
atttttaattctgggtcagagacctacaccgggtcatcagatgaccagcttccaggctgg
aaatctggatctcaacgaaagagagttgttggcattccagggagagtcccaatcgttcca
ttttcgatacctgaaaataatgatgatcaagatgatggctatatcagcgtgaaaaactct
aaaagaagtgatgcatcaatccacaacagtttatcaaggcaaacgtctgcttcaagcatc
actcaagggctcgggctgtcatcctcaaagagggatcctcctgatactgatctccacccg
caagtcatcaacccagattattgcccatgggaggaccaggcacctgctgactcaaccact
acactcctgcacacaagagacccttccaaactggatgatgtcactggcaacttcgacctg
gtggtcaaaacaaactcccctgagtcatgttgggcttacctgacgaatctggagagaaga
ggcaacccacacacggacatcaacctcctcaataaactcaaggactgttattctaaagtc
ttttccaagttacagatacagcaattcagcaaaaatgtcagttatgccaagatattggtg
cgttatgcagagctcagagggattgaagatccagatgaagcgcaggaccactttattgtt
gctcgatccaactgcaaagggtttgcctttgtccacatcgctcacgctcagtttgaggtt
tctcaaggtaatgtgatcaaagccacttcaatccttcacaaagcccaggcaatgaatgcc
aaaccagcacaactcctagagatggccatatgtaatttaaagactggggcaaaacaattg
gtaccttccagggatgaggaaaaggaaccatcctcgggtttaccggtcacttttcccact
gctgggggaaaccaggaagtgcatgttcctgctcggatccctgtgaactggccagtggaa
cagcctaaaggccccaaccgggaacctctttctgagtggaagattccaacctttgtcagt
cggcacgtttctccagaggaaaagcgcattacaccccctgagcccggacccatttctcgt
gtcccagagttaatacccattccatccagacaactcttacaaagtgtttgccagacccca
aacacctcttccatccacaatgcaaacagctttgtgacgcctgttgttaaaagagcccct
gaagtaccattttctgcagtggcaccacacagaactggaccagctcagcatcccttcaca
ccaataagtcaaacaccgtctttccaaacaccacagtcttcattaacttcaatttcaaat
gaatccatcaccattaagggcaaacagttctttgttcttaagatgattggacgtggtggt
tccagcaaggtctaccaggttcttggccacaagaaccagctttttgctgtgaaatatgtt
gacctggaggaagcggatgctcagactatagagagctacaagaatgagatcgagcatctg
aatcacctgcagcaatacagcgatcaaattattaagctatacgactatgagataaccaac
agctacatctatatgctgatggaatgtgggaacttggatctgaacacttggctgagaaac
cgcaaaactgtgaatcccctggagagaaagttttactggaataacatgctggaggctgtg
caaactatccacaatcatggtattgtccacagtgacttgaagccagcgaactttgtcatt
gtgaatgcttcactgaagttgattgactttggcattgccaacagaatccagcctgatgtt
acaagtattatgaaggattcacaggttggaaccctgaactacatgcctccagaagccatc
aaagacacttcgtccaagccaggaaaagcccgttcaaagataagtcccaaaggagatgtg
tggtcccttggatgcatcctgtactgcatgacgtatgggaaaacaccattccaaagcatc
acaaatcagattgccaagctgcaggccataattgatccttcccacaagattgactttcca
gatataccagagaaggacctgctggatgttctgaagcggtgtctgatacgaaaccccaga
gagagaatttgtattgctgaactgctggagcatccataccttcagctaaaaccacaaatg
tcaccgcaacgagtgcctccatgtaatggtgatttaaagaagatcctgacagacctcgca
gttctccattctccaaacagcattgtccgagccgctaatagtctggcaaaaatgtgcagc
agcggccataggttggatgtggcagagtgtgcaaaaccgtcctcttaa

DBGET integrated database retrieval system