KEGG   Takifugu rubripes (torafugu): 101073305Help
Entry
101073305         CDS       T02386                                 

Definition
alpha-galactosidase A-like
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tru00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tru00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tru00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:tru00603]
Cellular Processes; Transport and catabolism; Lysosome [PATH:tru04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 429 aa AA seqDB search
MYISVFALVFLIGPAAEALDNGLALTPTMGWLHWERFMCNTDCDQDPDNCISERLFMQVA
DVMVKEGWKEAGYEYVCIDDCWPYHQRDNQGRLQADPKRFPGGIKKLADYVHSRGLKLGI
YADVGNKTCAGYPGSLGYYDTDAQTFAEWGVDLLKFDGCFMDWTLLGEGYMNMSRALNQT
GRSIVYSCEWPLYEWRFQKPNYTAIRETCNHWRNSADVLDSWSSIKSISAWTADYQDTIV
PAAGPGGWNDPDMLVIGNFGLSHDQQESQMALWAIMAAPLFMSNDLRNICPRSKELLQNE
HVIGINQDPLGKQGYLSGKVDSFEVWERPLSKQRLAIAVLNKQEIGGPRGFVIRAAQGWR
VCTPACNVTQILPQYKDMGVQPMFSKMVVRVNPSGTVLLTVVPVSGDFKEVYSMEWQDTS
VRHHNNAFL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtacatttctgtgtttgccctcgtctttttaatcgggcccgcagcggaagctctggac
aacggcctggctctgacccccaccatgggctggttacactgggagaggttcatgtgtaat
actgactgtgaccaagacccggacaactgcatcagcgagcgtctattcatgcaggtggcg
gatgtgatggtgaaggagggctggaaggaggccggttatgagtacgtctgcattgatgac
tgctggccttaccaccagcgggacaaccagggccgtttgcaggcagaccccaaaagattc
ccgggagggattaagaaattggccgactatgtgcactccagagggctgaagctgggcatc
tacgcagacgtggggaacaaaacctgcgctgggtaccccggcagtctgggttactatgac
accgatgctcagacctttgctgaatggggggtggatttactcaagtttgacggctgcttc
atggactggaccttgttaggagaaggctacatgaacatgtctagagcactgaatcaaact
gggagaagcattgtgtactcctgcgagtggcctctctatgaatggcgcttccagaagcca
aactacactgcaattcgtgagacgtgcaaccactggcggaacagcgccgacgtgctcgac
tcgtggagctccatcaaatccatctcagcgtggactgcggattatcaggacacgattgtc
cccgctgctggacctgggggctggaatgaccccgacatgctggtgatcggaaacttcggc
ctgagtcacgaccagcaagagtctcagatggcgttatgggccatcatggcggccccgctg
ttcatgtctaacgacctgagaaacatctgccctcgctcgaaagagctgctgcagaacgaa
cacgtcatcggcatcaaccaggacccactggggaagcaaggctacctctcggggaaggtg
gacagctttgaagtgtgggagagacctctgtcgaagcagcgactggccatcgcggttctg
aacaaacaggagatcggtggtcccagaggcttcgtgatcagagcggcccaggggtggagg
gtctgtacgcctgcctgtaacgtcacgcagatcctcccccagtacaaggacatgggcgtt
cagccaatgttcagtaaaatggtcgtaagagtcaacccttcaggcaccgtcctgctgaca
gtcgtgcccgtcagcggcgactttaaagaagtttacagcatggagtggcaggacacgtct
gtcagacaccacaacaatgcctttctatag

DBGET integrated database retrieval system