KEGG   Takifugu rubripes (torafugu): 101073305Help
Entry
101073305         CDS       T02386                                 

Definition
alpha-galactosidase A-like
Orthology
K01189  
alpha-galactosidase [EC:3.2.1.22]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Lysosome
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    101073305
  Lipid metabolism
   00561 Glycerolipid metabolism
    101073305
   00600 Sphingolipid metabolism
    101073305
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    101073305
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    101073305
Enzymes [BR:tru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     101073305
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 429 aa AA seqDB search
MYISVFALVFLIGPAAEALDNGLALTPTMGWLHWERFMCNTDCDQDPDNCISERLFMQVA
DVMVKEGWKEAGYEYVCIDDCWPYHQRDNQGRLQADPKRFPGGIKKLADYVHSRGLKLGI
YADVGNKTCAGYPGSLGYYDTDAQTFAEWGVDLLKFDGCFMDWTLLGEGYMNMSRALNQT
GRSIVYSCEWPLYEWRFQKPNYTAIRETCNHWRNSADVLDSWSSIKSISAWTADYQDTIV
PAAGPGGWNDPDMLVIGNFGLSHDQQESQMALWAIMAAPLFMSNDLRNICPRSKELLQNE
HVIGINQDPLGKQGYLSGKVDSFEVWERPLSKQRLAIAVLNKQEIGGPRGFVIRAAQGWR
VCTPACNVTQILPQYKDMGVQPMFSKMVVRVNPSGTVLLTVVPVSGDFKEVYSMEWQDTS
VRHHNNAFL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtacatttctgtgtttgccctcgtctttttaatcgggcccgcagcggaagctctggac
aacggcctggctctgacccccaccatgggctggttacactgggagaggttcatgtgtaat
actgactgtgaccaagacccggacaactgcatcagcgagcgtctattcatgcaggtggcg
gatgtgatggtgaaggagggctggaaggaggccggttatgagtacgtctgcattgatgac
tgctggccttaccaccagcgggacaaccagggccgtttgcaggcagaccccaaaagattc
ccgggagggattaagaaattggccgactatgtgcactccagagggctgaagctgggcatc
tacgcagacgtggggaacaaaacctgcgctgggtaccccggcagtctgggttactatgac
accgatgctcagacctttgctgaatggggggtggatttactcaagtttgacggctgcttc
atggactggaccttgttaggagaaggctacatgaacatgtctagagcactgaatcaaact
gggagaagcattgtgtactcctgcgagtggcctctctatgaatggcgcttccagaagcca
aactacactgcaattcgtgagacgtgcaaccactggcggaacagcgccgacgtgctcgac
tcgtggagctccatcaaatccatctcagcgtggactgcggattatcaggacacgattgtc
cccgctgctggacctgggggctggaatgaccccgacatgctggtgatcggaaacttcggc
ctgagtcacgaccagcaagagtctcagatggcgttatgggccatcatggcggccccgctg
ttcatgtctaacgacctgagaaacatctgccctcgctcgaaagagctgctgcagaacgaa
cacgtcatcggcatcaaccaggacccactggggaagcaaggctacctctcggggaaggtg
gacagctttgaagtgtgggagagacctctgtcgaagcagcgactggccatcgcggttctg
aacaaacaggagatcggtggtcccagaggcttcgtgatcagagcggcccaggggtggagg
gtctgtacgcctgcctgtaacgtcacgcagatcctcccccagtacaaggacatgggcgtt
cagccaatgttcagtaaaatggtcgtaagagtcaacccttcaggcaccgtcctgctgaca
gtcgtgcccgtcagcggcgactttaaagaagtttacagcatggagtggcaggacacgtct
gtcagacaccacaacaatgcctttctatag

DBGET integrated database retrieval system