KEGG   Takifugu rubripes (torafugu): 101073400Help
Entry
101073400         CDS       T02386                                 

Definition
single-strand selective monofunctional uracil DNA glycosylase-like
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    101073400
Enzymes [BR:tru01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     101073400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 269 aa AA seqDB search
MSGDGNQLAHGFEALNPAEEANLSPAQRFLQVELELNVHLQQLTFSEPVRYIYKPLEYAW
ETHRCYVEKYCRGGQSILFLGMNPGPFGMAQTGVPFGEVKSVVDWLKITGEVGRPPDEHP
KRRITGLSCIRSEVSGARFWGFFKKLCDEPARFFQHCFVHNLCPLIFMSASGKNLTPPDL
PIAERKSLLAHCDTALCQAVKALGISMVIGVGRVAEQQARRALSEAGIDVRVEGIMHPSP
RNPQANKGWEEVVRAKLEELDVLSLLTRA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcgacggaaaccagctcgctcatgggttcgaggctttaaatccagcagaggag
gcgaacctttctcctgcccaaagattcctgcaggtcgaactggagctgaacgtccacctc
cagcagctcactttcagcgagccggtccggtacatttacaagccgctggagtacgcctgg
gaaacccaccgctgctacgtagaaaagtactgccgaggcggacaaagcatcctgttttta
gggatgaacccaggacctttcggcatggcgcagacaggggtgccgtttggtgaagtcaag
tcggtcgttgattggcttaagatcacgggggaggttggtcggccgcctgatgagcatcca
aagcgaaggataaccggactctcctgcattcggagcgaagtgagcggagcacgcttctgg
ggcttcttcaagaagctgtgcgatgaaccggcacgcttcttccagcactgctttgtgcac
aatctgtgcccgctcatcttcatgagtgccagcggcaagaatttaacaccccctgacctg
cccatagctgaacggaagtccctcctggcacactgtgacaccgcactgtgccaggctgtg
aaggcgttggggatctccatggtgatcggggttggaagagtggcagagcagcaggcacgg
cgtgctttatctgaggcagggatcgatgtgcgtgtcgaggggatcatgcatccatcaccc
aggaacccacaagccaataaaggctgggaggaggtagttcgagccaaactggaagaactg
gatgtcctttcactgctgacccgtgcatga

DBGET integrated database retrieval system