KEGG   Takifugu rubripes (torafugu): 101073662Help
Entry
101073662         CDS       T02386                                 

Definition
trifunctional enzyme subunit alpha, mitochondrial-like
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101073662
   01212 Fatty acid metabolism
    101073662
  Carbohydrate metabolism
   00640 Propanoate metabolism
    101073662
   00650 Butanoate metabolism
    101073662
  Lipid metabolism
   00062 Fatty acid elongation
    101073662
   00071 Fatty acid degradation
    101073662
   01040 Biosynthesis of unsaturated fatty acids
    101073662
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101073662
   00310 Lysine degradation
    101073662
   00380 Tryptophan metabolism
    101073662
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101073662
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     101073662
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     101073662
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 764 aa AA seqDB search
MMAGVRALGVLSRFTARRYTLSSGAASRTFSVASSMLARTHVDYEVKGDVAVVRINDPNS
KVNTLSVQMQNELTEIMNEIWANNDVKSAVLISKKPGCFIAGADINMIQACADSEEITKL
SQEGQKMFEKIEKSPKPIVAAINGSCLGGGLEFAIACQYRIATKSKKTVLGTPEVMLGLL
PGAGGTQRLPKMVGLPSAFDMMLTGRNIRADKAKKMGLVNELVDPLGPGLMSPEERTINY
LEEVAIECARGIVNKKIPLRKEKGTMQKIQDYIMSYPVVRNQIYKTVQGKVMKQSKGLYP
APLKIVECVKTGLEQGPTAGYLAESQNFGHLGKTPESAALIGLYHGQVACKKNRFGTPQR
EVKTLAVLGAGLMGAGIAQVTVDKGVSTILKDTTVAGLARGQEQVYKGLNTKTKKKSITS
FERDSILSNLRGQLDYNGFEKADMVIEAVFEDINIKHAVVKEVEAVIPPHCIFATNTSAL
PIKDIAAASKRPDKVVGMHYFSPVDKMQLLEIISTEQTSKDTIASAVAVGLKQGKVIIVV
GDGPGFYTTRCLAPMLAEAVRVLQEGVDPKKLDSLTTSFGFPVGAATLADEVGIDVAAHV
AEDLGKAFGSRFGGGNVEVLKTMVDLGFKGRKSGKGCYVYQPGLKSKEINPEIGEILEKY
RMTPHPTVSSDSDVQYRLVSRFVNEAVLCLQEGILNNPLEGDIGAVFGLGFPPCLGGPFR
FVDTFGADKLVEKMRQYEAVYGNQFTPCQLLLDHAKDSSKKFHK
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgatggctggtgttcgagcccttggtgttctttccaggttcacagcaaggagatataca
ctctcctcaggcgctgcttctcgcaccttctcagtagcttcttcaatgttggcccgaact
catgttgactatgaagtcaagggcgatgttgctgtggtacgaatcaacgaccccaactcc
aaggtcaacacactgtcagtccaaatgcagaatgagttgacagaaataatgaatgaaatc
tgggccaataatgatgttaaaagtgctgtcctcatatctaaaaagccaggatgcttcatt
gcaggagctgacatcaatatgattcaggcctgtgcggattctgaagaaatcaccaaactg
tctcaagaagggcagaagatgttcgagaagattgaaaagtctcccaaacccattgttgct
gccatcaatggctcttgtttaggaggtggcttggagtttgccattgcctgtcagtacaga
attgcaacaaagagtaagaaaacagttctcggtactcctgaagtgatgctggggcttcta
cctggagctggtggtacccaaagactccctaaaatggtgggtctgcccagtgcctttgac
atgatgctgacgggaagaaacatccgagcagataaagccaaaaagatggggctagttaac
gaacttgtagaccctctcggacctgggctaatgagtcctgaggaaagaaccataaactac
cttgaggaagttgccattgagtgcgccagagggattgtcaacaagaagatccctcttcgc
aaggaaaaaggcacaatgcagaaaattcaagactacattatgagctacccagtggtacgg
aatcagatctacaaaaccgtccaaggcaaagttatgaagcagagcaagggactctaccca
gcgcccctgaaaatagttgaatgtgtaaagacgggactagaacaaggccccactgcggga
tacttggctgagtctcagaattttggtcacttgggaaaaaccccagaatccgcagccttg
attggcctttatcacggccaggttgcctgcaagaagaaccgctttggaactcctcagaga
gaagtcaagaccctggccgtcctgggagcaggtttgatgggagcaggtatcgcccaggtg
acggtggacaaaggcgtgagcaccatcctgaaggacaccactgttgctgggctcgccaga
ggacaagagcaagtttacaaaggactgaacaccaagacgaaaaagaagagcatcacatcg
tttgagagggactccatcttgtccaacttgaggggccagctagattacaatggcttcgaa
aaggctgacatggttatcgaagctgtgtttgaagacatcaacattaagcatgcagttgtg
aaggaagtggaggctgtgattccccctcactgcatatttgccaccaacacgtctgctctg
cccattaaggatattgctgccgccagcaagagaccagacaaggtggttggaatgcactac
ttctctccagtggacaagatgcagcttttggagatcataagcactgagcagacatcgaag
gacaccatagcctctgcagtggcagtcggtctgaagcagggcaaagtcatcattgtagtt
ggagatggacctgggttctacacaacaaggtgtctggctcccatgttggctgaagcagtg
agagttcttcaggaaggagtcgaccctaagaaattagattctctcaccacgtcttttggc
ttccctgtgggtgcggccacgcttgctgatgaagtgggtatcgacgtggctgcccacgta
gcggaggacctcggcaaagccttcggatcccgctttggcggtggaaacgtggaggttctg
aagaccatggtggacctgggtttcaagggtcgcaaatctggaaagggttgctacgtttac
cagccaggactcaaatccaaagagatcaacccagaaattggagagatcctggagaaatac
aggatgacgccacatcctactgtgtcgtcggactctgatgtgcagtacagactggtttct
cggttcgtgaatgaggccgtgctgtgcctgcaggaaggcatcctcaataacccgttggaa
ggggacatcggggctgtgtttggcctgggattccccccctgccttggaggtcctttccgc
tttgttgacacattcggtgcagacaagttggtcgagaagatgaggcagtatgaagccgtc
tatgggaaccagttcactccgtgccagctcctactggaccatgctaaggattctagcaag
aagttccacaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system