KEGG   Takifugu rubripes (torafugu): 101073728Help
Entry
101073728         CDS       T02386                                 

Definition
peroxisomal bifunctional enzyme-like
Orthology
K07514  
enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:tru01200]
Metabolism; Overview; Fatty acid metabolism [PATH:tru01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tru00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:tru00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:tru00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:tru00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:tru00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:tru00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:tru00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:tru04146]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:tru03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 718 aa AA seqDB search
MAQYRRVSGSVGLITLQNPPVNALSASVRQGIVDSVKRALGDQKVKSVVICGQNGVFCGG
ADIREFGRQMSGPPLVPMIHDIEAANKPVVAAIEGSALGGGLELALGCHYRISHSKAKLG
LPEVTLGLLPAAGGTQRLPRLIGVPAALNLITTGRHVTAAEALQLGILDHVTEHNTVDVA
VKFALSVTGESLDGRRISSFSCAPLSDLDSLFEEAMLKVRGAARGAIAPVACVQAVRAAA
TLPYAQGMEREKELMATLFHSGQARALQYFFFAQRAVGRWSTPSGARWDTSQPRPVRKAA
VIGLGTMGRGITVALAQAGLSVVAVETHAKQLMEAKKAVPSMLKRGAVRGGTTIEPDSIT
YSETVQAVADVDLVIEAVFEDMALKEKVFQQLSIVCKPDTLLCTNTSSLDVDHLASQTRH
PELVVGMHFFAPAHVMKLLEVVYGRRSSPAAVATAMQLGKKMGKVSVAVGNCRGFAGNRM
LKRYLEQAFFLLEEGATPELVDRALEEFGFPMGVFRMSDLSGLDVGWRVRKADGLADTSL
TGTSARVRQGCRYSPLGDLLCEHGRFGQKTGRGWYQYDKPGGRVAKSDPWLHNFLDEYRA
RHGLVPRCIDQQEVLERCLFVLINEGFQILEEGIAAGPEDIDAIYVFGYGWPRHRGGPMF
YADMVGLERVVERLERYHQAHPNVPYLQPSGLLRRLVANGSPPIHKWRNVIKNRNSQL
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtatagacgtgtttcaggctcggttgggttgataactctgcagaatccgcct
gtaaacgcactgagtgcctctgtgaggcagggcatcgttgactcagtgaagagagcactg
ggtgaccaaaaggtaaagtctgtggtcatctgtggacagaatggagtcttttgtggaggg
gcagacattagggagtttgggagacagatgtcaggccctccacttgttccaatgatccat
gatattgaggctgcaaacaaaccagtggtggcggccatagaaggcagtgctttaggcgga
ggccttgagctggcacttgggtgccattatcgaatctcacattcaaaggccaaattgggg
cttccagaggtgacgctgggtctgctgccggctgcagggggaacgcaacgtctgccaaga
ctcatcggtgtcccggctgctttaaacctcatcaccacaggccgtcatgtgactgccgct
gaggcacttcagcttggaattctggatcatgtgactgagcacaacaccgtggatgtggct
gtgaagtttgcattgagcgtcacaggagagtcccttgatggccgccgcattagcagcttt
agttgcgcccccctttctgatttggattccctgtttgaagaagcgatgctgaaggtgcgt
ggtgctgcacgtggggctatagcgccggtggcctgcgtccaggccgtgcgagcggctgcc
accctgccctacgctcagggcatggagcgggagaaggagctgatggccacacttttccac
tccggccaggctcgcgccctgcagtacttcttctttgcccaaagggccgtgggcaggtgg
agcacgcccagcggagcccggtgggacaccagccaacccaggcctgtacgcaaagcagcc
gtcatcggtctcggcacaatgggaagaggcattacagtggccctggctcaggcaggcttg
tctgtggttgctgtggagacccatgcgaagcagttgatggaggcaaagaaagctgtcccc
agcatgttaaagcgaggagcagtcagaggagggacaactatcgaacctgacagcattacc
tacagcgaaaccgtccaggctgtggctgatgtcgacctggtcattgaggctgtgtttgag
gacatggcgctaaaggagaaggttttccaacagctgtccatcgtctgtaaaccagacact
ctactgtgcaccaacacctcctcgctagacgtggatcacctggcctctcaaacgcgccac
ccagaattggtggtcgggatgcacttctttgccccggcccacgtgatgaagctgctggag
gtggtttacggccggcggtcttcccccgcagccgtagccaccgcgatgcagctcggaaag
aaaatgggcaaagtcagcgtggccgtcgggaactgccgcggctttgctgggaaccgcatg
ctgaagcgatacctggagcaggccttcttcctgttagaggagggggccacccctgaattg
gtagatcgggccctggaggagtttgggttccccatgggggtgttcagaatgtctgacctc
tctgggctggacgtgggctggagagttaggaaggctgacgggctggcggacaccagctta
acggggacatctgcaagagtccgacagggctgcaggtacagccccctgggtgacctgctt
tgtgagcatgggcgctttggccaaaaaacaggccggggctggtaccagtatgacaaacca
ggtggccgtgtagccaagtctgacccttggctgcacaacttcctggatgaataccgagcc
cgacatggcctggttccacggtgtatagaccagcaggaggtgctggagcgctgtctcttt
gtcctcatcaatgaaggatttcagatcctggaggaagggatagctgccggacccgaagac
atcgacgccatctatgtgttcggctacggctggccgaggcaccgcggaggacccatgttc
tacgcagacatggttggactggagagggtggtggaaaggctggagcgctaccatcaggcc
caccccaacgtgccgtacctgcagccctccggcctcctcagaaggctggtggccaacggc
agcccgccgatccacaaatggagaaatgtcatcaagaaccgcaacagccagctttaa

DBGET integrated database retrieval system