KEGG   Takifugu rubripes (torafugu): 101073728Help
Entry
101073728         CDS       T02386                                 

Definition
peroxisomal bifunctional enzyme-like
Orthology
K07514  
enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
PPAR signaling pathway
Peroxisome
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101073728
   01212 Fatty acid metabolism
    101073728
  Carbohydrate metabolism
   00640 Propanoate metabolism
    101073728
   00650 Butanoate metabolism
    101073728
  Lipid metabolism
   00071 Fatty acid degradation
    101073728
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101073728
   00310 Lysine degradation
    101073728
   00380 Tryptophan metabolism
    101073728
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101073728
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    101073728
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101073728
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     101073728
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     101073728
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     101073728
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 718 aa AA seqDB search
MAQYRRVSGSVGLITLQNPPVNALSASVRQGIVDSVKRALGDQKVKSVVICGQNGVFCGG
ADIREFGRQMSGPPLVPMIHDIEAANKPVVAAIEGSALGGGLELALGCHYRISHSKAKLG
LPEVTLGLLPAAGGTQRLPRLIGVPAALNLITTGRHVTAAEALQLGILDHVTEHNTVDVA
VKFALSVTGESLDGRRISSFSCAPLSDLDSLFEEAMLKVRGAARGAIAPVACVQAVRAAA
TLPYAQGMEREKELMATLFHSGQARALQYFFFAQRAVGRWSTPSGARWDTSQPRPVRKAA
VIGLGTMGRGITVALAQAGLSVVAVETHAKQLMEAKKAVPSMLKRGAVRGGTTIEPDSIT
YSETVQAVADVDLVIEAVFEDMALKEKVFQQLSIVCKPDTLLCTNTSSLDVDHLASQTRH
PELVVGMHFFAPAHVMKLLEVVYGRRSSPAAVATAMQLGKKMGKVSVAVGNCRGFAGNRM
LKRYLEQAFFLLEEGATPELVDRALEEFGFPMGVFRMSDLSGLDVGWRVRKADGLADTSL
TGTSARVRQGCRYSPLGDLLCEHGRFGQKTGRGWYQYDKPGGRVAKSDPWLHNFLDEYRA
RHGLVPRCIDQQEVLERCLFVLINEGFQILEEGIAAGPEDIDAIYVFGYGWPRHRGGPMF
YADMVGLERVVERLERYHQAHPNVPYLQPSGLLRRLVANGSPPIHKWRNVIKNRNSQL
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtatagacgtgtttcaggctcggttgggttgataactctgcagaatccgcct
gtaaacgcactgagtgcctctgtgaggcagggcatcgttgactcagtgaagagagcactg
ggtgaccaaaaggtaaagtctgtggtcatctgtggacagaatggagtcttttgtggaggg
gcagacattagggagtttgggagacagatgtcaggccctccacttgttccaatgatccat
gatattgaggctgcaaacaaaccagtggtggcggccatagaaggcagtgctttaggcgga
ggccttgagctggcacttgggtgccattatcgaatctcacattcaaaggccaaattgggg
cttccagaggtgacgctgggtctgctgccggctgcagggggaacgcaacgtctgccaaga
ctcatcggtgtcccggctgctttaaacctcatcaccacaggccgtcatgtgactgccgct
gaggcacttcagcttggaattctggatcatgtgactgagcacaacaccgtggatgtggct
gtgaagtttgcattgagcgtcacaggagagtcccttgatggccgccgcattagcagcttt
agttgcgcccccctttctgatttggattccctgtttgaagaagcgatgctgaaggtgcgt
ggtgctgcacgtggggctatagcgccggtggcctgcgtccaggccgtgcgagcggctgcc
accctgccctacgctcagggcatggagcgggagaaggagctgatggccacacttttccac
tccggccaggctcgcgccctgcagtacttcttctttgcccaaagggccgtgggcaggtgg
agcacgcccagcggagcccggtgggacaccagccaacccaggcctgtacgcaaagcagcc
gtcatcggtctcggcacaatgggaagaggcattacagtggccctggctcaggcaggcttg
tctgtggttgctgtggagacccatgcgaagcagttgatggaggcaaagaaagctgtcccc
agcatgttaaagcgaggagcagtcagaggagggacaactatcgaacctgacagcattacc
tacagcgaaaccgtccaggctgtggctgatgtcgacctggtcattgaggctgtgtttgag
gacatggcgctaaaggagaaggttttccaacagctgtccatcgtctgtaaaccagacact
ctactgtgcaccaacacctcctcgctagacgtggatcacctggcctctcaaacgcgccac
ccagaattggtggtcgggatgcacttctttgccccggcccacgtgatgaagctgctggag
gtggtttacggccggcggtcttcccccgcagccgtagccaccgcgatgcagctcggaaag
aaaatgggcaaagtcagcgtggccgtcgggaactgccgcggctttgctgggaaccgcatg
ctgaagcgatacctggagcaggccttcttcctgttagaggagggggccacccctgaattg
gtagatcgggccctggaggagtttgggttccccatgggggtgttcagaatgtctgacctc
tctgggctggacgtgggctggagagttaggaaggctgacgggctggcggacaccagctta
acggggacatctgcaagagtccgacagggctgcaggtacagccccctgggtgacctgctt
tgtgagcatgggcgctttggccaaaaaacaggccggggctggtaccagtatgacaaacca
ggtggccgtgtagccaagtctgacccttggctgcacaacttcctggatgaataccgagcc
cgacatggcctggttccacggtgtatagaccagcaggaggtgctggagcgctgtctcttt
gtcctcatcaatgaaggatttcagatcctggaggaagggatagctgccggacccgaagac
atcgacgccatctatgtgttcggctacggctggccgaggcaccgcggaggacccatgttc
tacgcagacatggttggactggagagggtggtggaaaggctggagcgctaccatcaggcc
caccccaacgtgccgtacctgcagccctccggcctcctcagaaggctggtggccaacggc
agcccgccgatccacaaatggagaaatgtcatcaagaaccgcaacagccagctttaa

DBGET integrated database retrieval system