KEGG   Takifugu rubripes (torafugu): 101073728Help
Entry
101073728         CDS       T02386                                 

Gene name
ehhadh
Definition
(RefSeq) enoyl-CoA hydratase and 3-hydroxyacyl CoA dehydrogenase
  KO
K07514  enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00071  Fatty acid degradation
tru00280  Valine, leucine and isoleucine degradation
tru00310  Lysine degradation
tru00380  Tryptophan metabolism
tru00410  beta-Alanine metabolism
tru00640  Propanoate metabolism
tru00650  Butanoate metabolism
tru01100  Metabolic pathways
tru01200  Carbon metabolism
tru01212  Fatty acid metabolism
tru03320  PPAR signaling pathway
tru04146  Peroxisome
Module
tru_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
tru_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
tru_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    101073728 (ehhadh)
   00650 Butanoate metabolism
    101073728 (ehhadh)
  Lipid metabolism
   00071 Fatty acid degradation
    101073728 (ehhadh)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101073728 (ehhadh)
   00310 Lysine degradation
    101073728 (ehhadh)
   00380 Tryptophan metabolism
    101073728 (ehhadh)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101073728 (ehhadh)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    101073728 (ehhadh)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101073728 (ehhadh)
Enzymes [BR:tru01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     101073728 (ehhadh)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     101073728 (ehhadh)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     101073728 (ehhadh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 ApbA F420_oxidored TrkA_N
Motif
Other DBs
NCBI-GeneID: 101073728
NCBI-ProteinID: XP_003961995
Position
1
AA seq 718 aa AA seqDB search
MAQYRRVSGSVGLITLQNPPVNALSASVRQGIVDSVKRALGDQKVKSVVICGQNGVFCGG
ADIREFGRQMSGPPLVPMIHDIEAANKPVVAAIEGSALGGGLELALGCHYRISHSKAKLG
LPEVTLGLLPAAGGTQRLPRLIGVPAALNLITTGRHVTAAEALQLGILDHVTEHNTVDVA
VKFALSVTGESLDGRRISSFSCAPLSDLDSLFEEAMLKVRGAARGAIAPVACVQAVRAAA
TLPYAQGMEREKELMATLFHSGQARALQYFFFAQRAVGRWSTPSGARWDTSQPRPVRKAA
VIGLGTMGRGITVALAQAGLSVVAVETHAKQLMEAKKAVPSMLKRGAVRGGTTIEPDSIT
YSETVQAVADVDLVIEAVFEDMALKEKVFQQLSIVCKPDTLLCTNTSSLDVDHLASQTRH
PELVVGMHFFAPAHVMKLLEVVYGRRSSPAAVATAMQLGKKMGKVSVAVGNCRGFAGNRM
LKRYLEQAFFLLEEGATPELVDRALEEFGFPMGVFRMSDLSGLDVGWRVRKADGLADTSL
TGTSARVRQGCRYSPLGDLLCEHGRFGQKTGRGWYQYDKPGGRVAKSDPWLHNFLDEYRA
RHGLVPRCIDQQEVLERCLFVLINEGFQILEEGIAAGPEDIDAIYVFGYGWPRHRGGPMF
YADMVGLERVVERLERYHQAHPNVPYLQPSGLLRRLVANGSPPIHKWRNVIKNRNSQL
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtatagacgtgtttcaggctcggttgggttgataactctgcagaatccgcct
gtaaacgcactgagtgcctctgtgaggcagggcatcgttgactcagtgaagagagcactg
ggtgaccaaaaggtaaagtctgtggtcatctgtggacagaatggagtcttttgtggaggg
gcagacattagggagtttgggagacagatgtcaggccctccacttgttccaatgatccat
gatattgaggctgcaaacaaaccagtggtggcggccatagaaggcagtgctttaggcgga
ggccttgagctggcacttgggtgccattatcgaatctcacattcaaaggccaaattgggg
cttccagaggtgacgctgggtctgctgccggctgcagggggaacgcaacgtctgccaaga
ctcatcggtgtcccggctgctttaaacctcatcaccacaggccgtcatgtgactgccgct
gaggcacttcagcttggaattctggatcatgtgactgagcacaacaccgtggatgtggct
gtgaagtttgcattgagcgtcacaggagagtcccttgatggccgccgcattagcagcttt
agttgcgcccccctttctgatttggattccctgtttgaagaagcgatgctgaaggtgcgt
ggtgctgcacgtggggctatagcgccggtggcctgcgtccaggccgtgcgagcggctgcc
accctgccctacgctcagggcatggagcgggagaaggagctgatggccacacttttccac
tccggccaggctcgcgccctgcagtacttcttctttgcccaaagggccgtgggcaggtgg
agcacgcccagcggagcccggtgggacaccagccaacccaggcctgtacgcaaagcagcc
gtcatcggtctcggcacaatgggaagaggcattacagtggccctggctcaggcaggcttg
tctgtggttgctgtggagacccatgcgaagcagttgatggaggcaaagaaagctgtcccc
agcatgttaaagcgaggagcagtcagaggagggacaactatcgaacctgacagcattacc
tacagcgaaaccgtccaggctgtggctgatgtcgacctggtcattgaggctgtgtttgag
gacatggcgctaaaggagaaggttttccaacagctgtccatcgtctgtaaaccagacact
ctactgtgcaccaacacctcctcgctagacgtggatcacctggcctctcaaacgcgccac
ccagaattggtggtcgggatgcacttctttgccccggcccacgtgatgaagctgctggag
gtggtttacggccggcggtcttcccccgcagccgtagccaccgcgatgcagctcggaaag
aaaatgggcaaagtcagcgtggccgtcgggaactgccgcggctttgctgggaaccgcatg
ctgaagcgatacctggagcaggccttcttcctgttagaggagggggccacccctgaattg
gtagatcgggccctggaggagtttgggttccccatgggggtgttcagaatgtctgacctc
tctgggctggacgtgggctggagagttaggaaggctgacgggctggcggacaccagctta
acggggacatctgcaagagtccgacagggctgcaggtacagccccctgggtgacctgctt
tgtgagcatgggcgctttggccaaaaaacaggccggggctggtaccagtatgacaaacca
ggtggccgtgtagccaagtctgacccttggctgcacaacttcctggatgaataccgagcc
cgacatggcctggttccacggtgtatagaccagcaggaggtgctggagcgctgtctcttt
gtcctcatcaatgaaggatttcagatcctggaggaagggatagctgccggacccgaagac
atcgacgccatctatgtgttcggctacggctggccgaggcaccgcggaggacccatgttc
tacgcagacatggttggactggagagggtggtggaaaggctggagcgctaccatcaggcc
caccccaacgtgccgtacctgcagccctccggcctcctcagaaggctggtggccaacggc
agcccgccgatccacaaatggagaaatgtcatcaagaaccgcaacagccagctttaa

DBGET integrated database retrieval system