KEGG   Takifugu rubripes (torafugu): 101073735Help
Entry
101073735         CDS       T02386                                 

Definition
(RefSeq) histone acetyltransferase KAT7-like
  KO
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101073735
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 646 aa AA seqDB search
MERCFLPTMGSFLYYPLRTAGSSSDGTEDSDFSTDLEHTEAPKGSCTRSSSRLTRASLRL
SQNSQDSCNPVRSSSPAAVGAEEAHDTVAEASTAVAESSFSSERMVTRSQQWAANNKAKK
YSLRQSRSSGSDTEANDAKQRPDQDDTPPRTPTGNTLSSESDMEVCSPSNEVVSSSNNPI
VSQEEDERLAKELSLKEAAAHDLSHRPKRRRFHESYNFNMKCPTPGCNSLGHLTGRHERH
FSISGCPLYHNLSVDECKGKNTTRDKPAEERTLTHRQDENRHSTRSQAPSDRQLRYKEKV
TEIRRKRNSNLNKEQKDKCMDHLQNHGVSREPLLENITSDYDLELFRKAQARASDDLEKL
RLAGQVSEGSNMIKTIVFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRH
TAKCVWKHPPGDEIYRKGNISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFY
VMTEADNTGCHLVGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKV
GSPERPLSDLGLISYRSYWKEVLLRYLCNFQGKDISIKEISQETAVNPVDIVSTLQSLQM
LKYWKGKHLILKRQDLIDDWKAKETKRGHGKTIDPTALKWTPPKGT
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggagcgatgttttttgcccaccatgggatcttttctgtattatccactgaggaccgct
ggcagcagctcagatgggacagaggactctgacttctcaaccgatcttgagcacactgag
gcacccaagggttcgtgcacgcgcagcagttcacgcctaactcgagcatctcttcgtctc
agccagaattctcaagatagttgcaacccagtaaggagcagttctccagcagctgtgggg
gctgaagaggcccacgacaccgtggcagaggcatcaacagcagttgctgagtccagcttc
tcatcggagcgcatggtgacacgcagccagcagtgggcagcaaacaacaaagccaaaaaa
tactcactgcgccagagcaggtcttcaggctccgacacagaggctaatgacgcaaaacaa
agaccagaccaagatgatactcctcctcgcactccaactggcaacactctttcatcggag
tcagacatggaggtttgcagccctagcaacgaagtcgtgtcatctagcaacaatcccata
gtttcacaagaggaggatgaaagattggccaaagagctgtcactgaaagaggccgcggct
catgacctttcccaccggccgaaacgacgacgcttccacgagagttacaacttcaacatg
aagtgtcccacacctggatgcaactccctgggacatctaactgggagacatgagaggcat
ttctccatatctgggtgtcctctttaccacaatctttctgttgacgaatgcaagggcaaa
aacacaacacgtgacaaaccggctgaggaaagaacactgacacaccgccaggatgagaac
agacactccacaaggagccaggctccttcagatcgtcagctgcgctacaaggagaaggtg
acagagataaggaggaagaggaactctaacctcaacaaggaacagaaggataagtgcatg
gatcatctccaaaaccatggcgttagcagggagccgctgttggagaacatcaccagtgat
tacgacctagaactgttcaggaaagcgcaggcacgtgcctcggatgaccttgaaaagctt
cggctggctggtcaggtgtcagaaggcagcaacatgattaaaaccattgtgtttgggcga
tacgagttggatacctggtaccactcgccctacccagaggagtatgcccgcctagggagg
ctttacatgtgcgagttctgtctaaagtacatgaagagccaaactatcctgcgaagacac
acggcaaagtgtgtgtggaagcaccctccaggtgatgagatctacaggaaagggaacatc
tctgtctttgaggtggatggaaaaaagaacaagatttactgtcagaacttgtgtctgctg
gccaaactcttcctggatcacaagactctgtattacgatgttgagccttttctcttctat
gtcatgactgaagccgacaacacagggtgtcatctagttggatatttctccaaggagaag
aattccttcctaaactacaacgtgtcctgcatcctcaccatgccccagtacatgaggcaa
ggctatgggaaaatgctaatcgactttagttacctgctgtccaaggtggaagagaaagtg
ggctcacccgagcgcccgctgtctgatctgggcttaatcagctaccggagttattggaag
gaggtgctgttgcgctacctgtgtaactttcaggggaaagacatttcaatcaaagagatc
agccaggagacggcagttaatccagtggatatcgtcagcaccctgcagtcgctgcagatg
ctcaagtactggaagggaaaacacctgattttaaagagacaggaccttattgatgactgg
aaggccaaggagaccaagcggggtcatggcaagaccatcgatcctacagccttaaaatgg
acaccacctaaagggacgtag

DBGET integrated database retrieval system