KEGG   Takifugu rubripes (torafugu): 101073764Help
Entry
101073764         CDS       T02386                                 

Definition
multifunctional protein ADE2-like
Orthology
K01587  
phosphoribosylaminoimidazole carboxylase / phosphoribosylaminoimidazole-succinocarboxamide synthase [EC:4.1.1.21 6.3.2.6]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Purine metabolism
Metabolic pathways
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tru00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 425 aa AA seqDB search
MASTPELKIGKKLNEGKTKQIFELLDQPGLVLVQSKDQITAGNAARKDQMEGKAAIANKT
TSCVFKLLQESGIKTAFVKQHSDTAFIAAQCEMIPIEWVCRRVATGSFLKRNPGVKEGYR
FTPLKMEMFFKDDANNDPQWSEEQVLETKFSLAGLTIGQCEVDIMNRSTVAIFEILEKAW
ATQNCTLVDMKIEFGVNVKTQEVVLADVIDNDSWRLWPSGDRSQQKDKQVYRDLKEVTPE
AMQMVKRNFEWVSERVELLLHSRASGRVVVLMGSTSDMAHCEKIRKACSSFGIPCVLRVT
SAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVINCPPLTPDWGAQ
DVWSSLRMPSGLGCSTILSPEAAAQFAAQVFGLTDHQVWCKLRASMLNTWVSLKLADKKL
QACSL
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggcctccacaccagagttgaagatcggcaagaaactgaatgagggcaaaacaaagcag
atatttgagttactggaccagccgggattggttctggtccagtcgaaagaccagattaca
gctggaaatgctgcaaggaaagatcagatggaaggcaaggctgcgattgcaaataaaacg
acgagctgtgtcttcaaactcctccaggaatccggcatcaaaactgcctttgtgaagcaa
cactccgacacagcgttcatcgcggcccagtgcgagatgattccaattgagtgggtctgt
cggagggtcgccactgggtcgttcctcaagcggaacccaggagtcaaggaaggctaccgc
ttcacacccctcaagatggagatgttctttaaagacgatgccaacaacgacccacagtgg
tcagaggagcaggtgctggagaccaagttttccctggctggactcactattggccagtgc
gaggtagacatcatgaaccgcagcactgtggccatctttgagattctggagaaggcctgg
gccactcagaactgcacactggtggatatgaagattgagtttggcgtcaatgtgaagact
caggaggtggtccttgctgatgtgattgacaatgactcatggaggttgtggccatctgga
gatcgaagccagcagaaagacaagcaggtgtacagagacctgaaagaagtgacccctgag
gcgatgcagatggtgaaaaggaactttgagtgggtctctgaaagggttgagctgctgctg
cacagtcgggccagcggcagggttgtcgtattaatgggatccacttcagacatggctcac
tgtgagaaaatccgaaaggcctgcagctcctttgggattccctgcgtcctgagagtcacc
tcggcacacaaaggcccagatgagacgcttcgcatcaaagctgaatatgaaggtgatggc
atacccacagtctttgtggctgtggccggcagaagtaacggtctgggcccggtgatgtct
ggaaacacggcctatcccgtcatcaattgccctcctctcactccagactggggcgcgcag
gatgtctggtcctctctgcgtatgccgagcggcctcggctgttccaccatcctttccccc
gaagctgccgctcagtttgccgcgcaggtcttcggcctgaccgatcaccaggtgtggtgc
aaactgagggcgtccatgctcaacacctgggtgtccctgaagctggctgacaagaagctc
caggcctgcagcctctga

DBGET integrated database retrieval system