KEGG   Takifugu rubripes (torafugu): 101073792Help
Entry
101073792         CDS       T02386                                 

Definition
ribonuclease P protein subunit p20-like
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101073792
   03008 Ribosome biogenesis in eukaryotes
    101073792
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     101073792
Ribosome biogenesis [BR:tru03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     101073792
Transfer RNA biogenesis [BR:tru03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    101073792
Mitochondrial biogenesis [BR:tru03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    101073792
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 143 aa AA seqDB search
MSIASQSAQVHAESTPVTVEMDPVEYTLRKRLPRKLPKRRNDVYVNMKTDFRAQLARCQK
LLEGGGHREICIHGLGLAINRAINIALQLQASSQGVLQLAANTSTVELVDDLEPDDPDEA
REPMTRTRNNSAIHIKVFYPDPQ
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattgcctctcagtcggcacaagtgcacgccgagtccacccccgtgactgtggag
atggacccagtggagtatacacttcggaagcgcctccctaggaagctgccaaagaggcgg
aacgacgtgtatgttaacatgaagacggatttccgggcacagttggcacgctgtcagaag
ctcctggaaggaggcggccacagggagatctgcattcacggtctgggcctggccattaac
agggccatcaacatcgccctccagctgcaggccagcagtcagggggtgctgcagctggcg
gccaacacctccacggtggagctcgtggacgatctggagccggacgatcccgatgaagcc
agagagcccatgacacgtacgcgcaacaactctgctatccacattaaggttttctatcca
gacccacagtga

DBGET integrated database retrieval system