KEGG   Takifugu rubripes (torafugu): 101073921Help
Entry
101073921         CDS       T02386                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase 2-like
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     101073921
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   101073921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
18
AA seq 591 aa AA seqDB search
MLTKKPGVSVHPTGKAGEPGYSSGHSGSQTTSPAALPRLRANLNPLTGGAKVAMTDPVQL
LSHSQVHITQLFEENTNKRPVLASQLNGQARSGLSLPDHHATAAAATESPHHSRQGSATS
NKLMDSKPKPGFLSPEQAMKQFMSKLSTFEHHEVFNYPEVYFVGPNAKKRLGIMGGANNG
GYDDDQGSYIHVPHDHISYRYEVLKVIGKGSFGQVVKAYDHKCQTHVALKMVRNEKRFHR
QAAEEIRILEHLRKQDKDSGMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFS
LPLVRKFAYSILQCLDSLHKNRIIHCDLKPENILLKQQGRSGIKVIDFGSSCYEHQRVYT
YIQSRFYRAPEVILGSRYGMPIDMWSLGCILAELLTGYPLLPGEDEGDQLACTMELLGMP
GQKLLDASKRSKNFVSSKGYPRYCTVTTLPDGTTVLNGGRSRRGKARGPPGSKDWSAALK
GCDEPLFLDFLKQCLEWDPGLRMTPSQALRHPWLKKRLPKPPGGTTTTEKTSRRIGTTAT
DGAITSISKIATASSATMSSSSSSKTRTNLAAITDTNGNIQPRTVLPKLVS
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgttaacgaagaagcccggagtctcggtccacccgacgggcaaagcgggcgagccgggc
tactcttccggtcacagtggctcccagacgacatcgcccgccgccctgccgcggctccgc
gctaacctcaacccgctgacggggggcgctaaagtcgcaatgacggatcccgtccagctg
ttgtcgcactcgcaggtccacatcacccagctgttcgaggagaacaccaacaagcgtcca
gtcctcgcctcccagctcaacggccaggcccggtcggggttatcgctgccggaccaccac
gccaccgccgccgccgccaccgagtccccccaccacagccggcagggcagcgccacctcc
aacaagttaatggacagcaagccaaagcccggcttcctgagcccggagcaggccatgaag
cagttcatgtccaaactgtcgacctttgagcaccacgaggtgttcaactaccccgaggtg
tactttgttggtccaaatgccaagaagaggttggggattatgggcggagccaataacgga
ggttacgacgacgatcaggggtcatatatccacgttccgcacgaccacatatcctaccgc
tacgaggtgctgaaggtcatcggcaagggcagttttggacaggtggtaaaagcctacgac
cacaagtgccagacccacgtggcgctgaagatggtccgcaacgagaagcgcttccaccgg
caggcggcggaggagatccgcatcctggagcacctgaggaagcaggacaaggactcgggc
atgaacgtcatccacatgctggagaacttcaccttccgcaaccacatctgcatgaccttc
gagctgctcagcatgaacctctacgagctcatcaagaagaacaagttccagggcttcagc
ctgccgctggtccggaagttcgcctactccatcctccagtgtctggactcgctgcacaag
aaccgcatcatccactgcgacctgaagccggagaacatcctgctcaagcagcagggacgc
agcggcatcaaggtaattgactttggatccagctgttatgaacatcagagagtctacacc
tacatccagtccaggttctatagagcgccagaggtcattttaggttccagatacgggatg
ccgatcgacatgtggtctctgggctgcatcctggccgagctgctgacgggttacccgctg
ctccctggcgaggacgaaggcgaccagctggcctgcactatggagctgctgggcatgccc
ggtcagaagctgctcgacgcctccaaaaggtccaagaactttgtgtcctccaaaggatac
ccgcggtactgcaccgtcaccacgttgcccgacggcaccaccgtgctgaacggcggccgg
tcgaggcgggggaaggcgcgcggcccgccgggcagcaaagactggagcgcggcgctgaag
ggctgcgacgagcctctgttcctggacttcctcaagcagtgtttggagtgggacccgggc
ctcaggatgacacccagccaggcgctgcggcacccgtggctgaagaaacgactccccaag
cctccgggcgggaccaccacaacggaaaagacctccaggcgaatcggcaccaccgccacg
gacggcgccatcacctccatctccaaaattgccaccgcctcctcagcaaccatgtcctcc
tcctcctcctccaaaaccaggactaacttggcagcaatcacggacactaacgggaatatc
cagccgaggacggttctaccaaagctggttagctga

DBGET integrated database retrieval system