KEGG   Takifugu rubripes (torafugu): 101073984Help
Entry
101073984         CDS       T02386                                 

Definition
CREB-binding protein-like
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:tru04310]
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:tru04330]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:tru04350]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:tru04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:tru04068]
Cellular Processes; Cell growth and death; Cell cycle [PATH:tru04110]
Cellular Processes; Cell communication; Adherens junction [PATH:tru04520]
Organismal Systems; Endocrine system; Melanogenesis [PATH:tru04916]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:tru05168]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 2278 aa AA seqDB search
MAENLLEMGPPSSKRPKLNSPALSASDGPDLGSLTWDDLENDLPDELIPNGGDLSLGGGG
SGVPDAAAKHKQLSELLRGGNSSSIASTGLNSANSQAGSMGPQLGTPLGKSPLGQGSPNN
HHSPQAQKAGTPSGVAGQNTNGNTAAMGLNSAGFNQTMINNGPSHGGLLPQGGQPQPGQM
MNGGLGADAGRVRAAGVGVMQYQGASMQAAAAGAGGAASALAETLTQGGQQMGAHTNLNG
AQQAGSLNKMGLSSNGGPFGAQPYGQGATGPGQQLNQQQQLQNKVTLANSLPPFHNELKG
AAVTNVPNMQLQQPQQQAPMLPMAGSGSVAVTSAGPTADPEKRKLIQQQLVLLLHAHKCQ
RREQANGEVRACALPHCRTMKNVLNHMTHCQAGKSCQVAHCASSRQIISHWKNCTRHDCP
VCLPLKNASDKRTQQPKLGSPNAGLQNSISSVGVGQPSPTINTSTPIDPSSMQRAYAALG
LPYSSQTTGQSQQGPGQQAGNQMALGGTAMGVTTSDQTNLHTDSVPNALNTNSQLLSDGS
AVGSMGNLPTAAPMSATGTRKAWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENL
VAYARKVEGDMYESANSRDEYYHFLAEKIYKIQKELEEKRRSRLQKQIMNQAPLAVQGTQ
QPSLPQPNAFGARPQNGPVPLPNMPNQIMNRMQVSQGMNQFNHMALPNAQISQAPMGARA
ASPMNHPQQMNLSAVPAMGMSPSRMPQAQGMMAGHGAGNMVGQTNSQGQFLAQSQFPTGA
AVNAAATMNVTVGSGMGQSPAQAAVTQLSQPGASLENRVPTPASASSADLHTQHVGADLP
TQEVKTDANHDQQDYEAACGKIEPKMEAEEDMVSVKKEEPEEKTESMEVEEKKPEPKEED
DAGANGTTSSSPSQSRRKIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPLLLGIPDY
FDIVKNPIDLSTIKRKLDTSQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVF
ESEIDPVMQGLGYCCGRKYEFSPQTLCCYGKQLCTIPTGGTYYSYQNRYHFCEKCFNEIQ
GDSVTLGDDPAQPQTMISKDQFERKKNDVLDPEPFVECKDCGRKMHQICVLHYEVIWPSG
FICKSCLKKSGKTRKENKFTAKRLQTTRLGMYIEDRVNKYLKRQNHPEAGEVFVRVVASS
DKTVEVKPGMKARFVDTGEMPETFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSECAFPN
TRRVYISYLDSIHFFRPRILRTAVYHEILIGYLEYVKKLGYTQGHIWACPPSEGDDYIFH
CHPPEQKIPKPKRLQEWYRKMLDKAFAERILHDYKDIFKQATEDRLTSANELPYFEGDFW
PNVLEESIKELEQEEEERKKEENTAASETPEGAQGDSKNAKKKNNKKTNKNKSSLSRANK
KKPGMPNVANDLSQKLYATMEKHKEVFFVIHLHSGPMANTLPPIVDPDPLLSCDLMDGRD
AFLTLARDKHWEFSSLRRCKWSTMCMLVELHNQGQDRFVYTCNECKHHVETRWHCTVCED
FDLCISCYNTKGHEHQMVKWGLGLDDDNNSQSGEASKSPQESRRLSIQRCIQSLVHACQC
RNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLN
IKHKLRQQQMQHRLQQAQLMKRRMATMQGRTMPLPSPPATAAPSTPTSHTQPNTPQTPQP
PLSNQPQTPNSARVMSPTFANAPRNGQPQAPVSQGKPGPQASPLHQQQSPLPQPPQAPQQ
LQQQPPPLAAVKMARHIEMMAQAQQNYRANMNGLPMNPPQQQQRMPGPVQPSMQMVPGPR
GAQVMQPGMTPGQWPAMMTPGQQPQQPARMLIPQQPGARPQTPQRPGTIAPNALQDLLRT
LKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYQANQPQQPGGQQQQPGMPTIQPMTM
AGAVQRPGMPPQQPQQPSAQGMASLGAQTQLMNPAHNTGPQVQEMYRRQLLRQQQQQQQQ
QQGVMPQGHPGQFPPQAQGTAATYSQLRMQQQQQQQQRGLGQLPPMSQMAQAGLGMDSTQ
NLLHQRMLQQQQQQQQQLPQQQQVVLKQQMGSPAQPSPMSPQTHLLAGQSQTGGHLPGQP
SLASALNNQVRSPAAVQSPCPSSQQQSQQQRPHSSPSPQVSNQAQPSPQHPHPPHSASPH
PGLGGTLSGSIEQGHLGTPEQSAMLPQLNTPNRGVLNSDLGMVGDTTGDTLESFVAQL
NT seq 6837 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaatctgctggagatgggacctcccagttccaagcggccgaagctgaattca
cctgccctgtcagcgtctgatggaccagatctggggtcacttacctgggatgatttggag
aacgatcttccggatgaattgatcccgaacggaggcgatctgagcctcggcggcggcggc
agcggcgttcccgatgcagctgctaagcacaagcagctctcggagctccttcgagggggt
aacagctccagtattgcgagcacaggactgaactcagccaactcccaagcaggtagtatg
gggccgcagctgggtacaccgctgggtaagagcccccttggccaaggctcccccaacaac
caccattcaccccaggctcagaaagcaggaacaccaagtggagttgctggacagaacacc
aacggtaatactgcagcgatgggtttgaactcagcgggatttaatcagacaatgattaat
aatggaccgagccacggcgggctcctcccgcagggcgggcaacctcaacctgggcagatg
atgaacggtggtcttggagccgatgctgggagagtacgagcggctggggtgggggtcatg
cagtaccagggagcgtcaatgcaggcagctgcagcaggagcgggaggagcagccagtgca
ttggcagaaacacttacccagggagggcagcagatgggggctcacaccaatctcaatggt
gcccagcaggcaggaagtctcaacaagatgggtctgagcagcaatgggggtccatttggg
gcccaaccctatggacagggtgctaccgggcctggccagcagctcaaccaacagcagcag
ctacagaacaaggttacccttgcaaacagtttgccacctttccacaatgagctgaaaggt
gctgctgtcactaacgtgccaaacatgcagctccagcagcctcaacagcaagcgcccatg
ctcccaatggctggcagcggcagtgtggcggtgacatcggcgggccccacagctgaccca
gagaaacgcaaattgatccagcagcagctggtcctgctgcttcatgcacacaagtgccag
cgccgggagcaggcgaacggcgaggtgagggcgtgcgctcttcctcactgccgcacaatg
aagaacgtcctcaaccacatgacccactgccaggctggcaagtcctgccaggtggctcat
tgtgcgtcatccagacagatcatttctcactggaaaaattgtacacgacatgactgtccc
gtctgcctgccgctgaagaatgccagtgacaaacgtactcagcaaccaaagctgggctcc
cctaatgcaggcctccagaactccatttcttcagttggtgtgggccagccaagtcccacc
attaatacctcaactcctatagacccctcctccatgcagagagcctacgcggcacttggg
ctgccgtacagcagccagacaaccgggcagagccagcagggcccaggacagcaagcaggt
aaccagatggctcttggaggcacagcaatgggtgtgaccacttcagaccagacaaacctg
cacacagattctgttcccaatgcactcaacactaacagtcagctgctgtcagacggttca
gctgtgggctcgatgggcaacctgcccactgcagcacccatgtcagccacaggcaccagg
aaagcgtggcacgagcacgtcactcaggacctgcgaagtcaccttgtgcataaactggta
caagccatattcccaaccccagatccggcagctttgaaggacagaaggatggagaacctt
gtagcgtatgccaggaaggtggaaggggacatgtacgagtcggctaacagtcgtgatgaa
tactatcattttctggctgagaaaatctataagatccaaaaggaactggaggagaagagg
cgctccaggctacagaagcagataatgaaccaagcacctttggctgttcagggtacacaa
cagcccagccttccccaacctaatgcctttggcgcaaggccacagaatggacctgttcct
ttgcccaacatgccaaatcaaatcatgaatcgcatgcaagtttcacaaggaatgaaccag
ttcaaccacatggctctccccaatgcccagatctctcaggcaccaatgggagcccgagct
gcttcgcctatgaaccacccacagcaaatgaacctgagtgccgtcccagcaatgggcatg
tccccatccaggatgccccaagcccagggcatgatggccggacatggggccggtaacatg
gtaggtcagacaaacagccagggacagtttcttgcacagagccagttcccgactggagct
gcagttaatgcggcagcgactatgaatgtcactgtgggatctggcatgggccaatcgcct
gctcaagctgctgttactcagttgtctcagcctggagccagcctggaaaaccgggtccct
acaccagcctcggcatccagtgctgacttgcatactcagcatgttggagcagacctacca
acccaggaggtcaaaaccgacgcaaaccatgaccaacaggactatgaggcagcatgcggc
aaaattgagcccaagatggaggctgaagaagacatggtatcggtaaagaaggaggagcca
gaagaaaagactgagtctatggaggtggaggagaaaaagccagaaccgaaggaagaggat
gacgctggagctaatggcacaacttcctcatctccctctcagtcaagaaggaaaatcttt
aagccagaggagttgcgtcaggcactaatgccaacgctggagtctctgtacagacaagac
cctgagtcactgcccttccgacagccagtagaccccttgcttctagggataccggactac
tttgacatcgtaaagaatccaatagacttgtccacaataaagcgcaaactcgatacaagt
cagtatcaagagccctggcagtacgtagatgatgtctggttgatgttcaacaatgcttgg
ttgtacaatcgcaagacatctcgtgtctacaagtactgttccaaactcgccgaggtgttc
gagtctgaaatcgaccctgtgatgcagggtctgggatactgctgtggaaggaagtatgag
ttctctccacaaactctctgttgctatggcaagcagctctgcaccatacccactggaggc
acatattatagctaccaaaacaggtatcatttctgtgaaaagtgcttcaatgagatccag
ggagatagtgtgacattaggagacgatcctgcacagccacaaacgatgatctcaaaagat
cagtttgaacgcaagaagaatgacgtactcgaccctgaaccgtttgttgaatgtaaagat
tgtggacggaagatgcaccaaatctgcgtcttacactacgaggtcatctggccatctgga
ttcatctgtaagagctgtttaaagaaaagtgggaaaacgcggaaggaaaacaagttcact
gcaaaacggctacagacaacacgactaggaatgtacattgaagaccgcgtaaataaatac
ttgaaaagacagaaccacccagaagctggagaggtgtttgtgcgagtggtggcgagctct
gataaaacggttgaagtaaaaccgggcatgaaagccaggtttgtggacactggagaaatg
cccgagacgtttccctacagaaccaaagcactttttgcctttgaggagattgatggtgtg
gacgtgtgcttctttggaatgcatgtccaggaatatggttcagagtgcgcattccccaac
actaggcgggtctacatatcataccttgacagtattcacttctttagacctcgcattcta
cggactgcagtataccatgagatcctcatcggatacttagaatatgtcaagaaactcgga
tatacccaaggccacatctgggcatgtccacctagtgaaggagatgactatatctttcac
tgccatccccctgaacagaagatcccgaagccaaagagactgcaggagtggtaccggaag
atgctggacaaggcttttgctgagagaattctgcatgactataaggacatcttcaaacag
gcaacagaagatcgccttaccagtgctaatgagttgccgtactttgagggtgacttctgg
cccaatgtgttggaagagagcatcaaggaattggaacaggaagaggaggagcggaagaag
gaagagaatacagctgcctctgaaactcccgagggtgcacaaggtgatagcaaaaatgca
aaaaagaagaacaacaagaagaccaataagaataagagcagcctgagccgagccaataag
aagaagcctgggatgccgaatgtagccaatgatctatcccagaagctctacgccaccatg
gagaagcacaaagaggtgttctttgtgatccacctccactctggacccatggccaatacg
ctgccccccattgttgaccctgaccctttgctctcttgtgacttgatggatggccgcgat
gccttcctgacgctcgccagggacaaacattgggagttcagctcgctcagaaggtgcaag
tggagcaccatgtgcatgcttgtggagctgcacaaccagggccaggaccgcttcgtgtat
acatgcaatgagtgcaaacaccacgtggagacacggtggcactgcactgtgtgtgaggac
tttgatctgtgcattagctgttacaacacaaagggacatgagcaccaaatggtgaaatgg
ggcctcggtctggatgatgacaacaacagtcagagtggtgaggcctccaagagcccacag
gagagccggcggttaagtatccagcgctgcatccagtccctcgtgcacgcgtgtcagtgc
cgcaatgccaactgctctctgccgtcctgccaaaagatgaagcgagtggtgcagcatacc
aagggttgcaagcgcaaaaccaatggcggctgccctgtatgcaagcagctgatcgcgtta
tgctgttaccatgcaaagcactgtcaggagaacaaatgcccggtcccgttctgcctcaac
atcaagcacaagctgcgtcagcagcagatgcagcacaggcttcagcaagcccagctgatg
aagaggcgaatggccaccatgcaaggcagaaccatgccactgccgtccccacccgccaca
gccgcccccagcactcccacgtctcacacgcagccaaacactccccagacgccgcagccg
ccactctccaatcagccccagacaccaaattcagcaagggttatgtctcctactttcgcc
aatgcgcctcgcaacggccagcctcaagcaccggtgtcgcagggcaagcctggaccccag
gcatcgcctctacatcaacagcagtccccgctcccccagccaccccaagcccctcagcag
ctacagcagcagccgccccccctcgccgcggttaagatggcgcgtcatattgaaatgatg
gcgcaggctcagcagaactaccgggcaaacatgaatggccttcccatgaaccctccacag
caacagcagcgcatgcccggaccagtacaaccatccatgcagatggtcccggggccaagg
ggggctcaagtcatgcaacctggcatgaccccgggacaatggccagccatgatgacccca
ggccagcaacctcagcagcccgcaaggatgttaattcctcagcagcccggtgccaggcca
cagacgccccaaaggcctggtactattgcacccaacgccctgcaggacctcctccgcacc
ctcaaatctcccagctcacctcagcagcaacagcaagtccttaacatcctcaaatcaaat
cctcagttaatggctgcattcatcaaacagcgtacagccaaatatcaggccaaccaaccg
cagcagcctggaggtcagcaacagcagcccggcatgccgacaatacaacccatgactatg
gcaggggcagtgcagaggccaggaatgccgcctcagcagccccagcagccttctgcacag
ggcatggcttcgttaggggctcaaacacagctgatgaacccagcgcacaacaccggaccc
caggtgcaggagatgtaccgtcgccagctcttaagacagcagcagcagcagcagcagcag
cagcaaggagtgatgccccagggccaccctggtcagttcccacctcaggcacaggggact
gcagcaacatactcccagcttcgcatgcagcagcagcagcagcagcagcagagaggcctg
ggccagctcccaccaatgtctcagatggcccaagcaggcctagggatggactccacccag
aacttactgcatcagcgaatgcttcagcagcagcagcagcagcagcagcaacttccacag
cagcagcaggttgtcctcaagcagcagatgggctctcctgcccagcccagcccaatgagc
ccccagacccacctgcttgcaggccagtctcaaaccggaggccaccttcctggacagcct
tcgttagccagcgcccttaacaatcaagtccgttcccctgcagcagtgcagtcgccgtgc
ccttcttctcagcagcagtctcagcagcagcggccacattccagtccctccccgcaggtc
tcaaatcaagcccagccctcgccacagcacccgcatcccccccactcggcatccccccac
cctggactcgggggcacgctgtcagggtccattgaacaggggcacttggggacacctgaa
caaagtgccatgctaccacagcttaacacacccaacaggggggtgctgaacagtgacttg
gggatggtgggggacactacaggagacactctggaaagtttcgtggcgcaattgtag

DBGET integrated database retrieval system