KEGG   Takifugu rubripes (torafugu): 101073984Help
Entry
101073984         CDS       T02386                                 

Definition
(RefSeq) CREB-binding protein-like
  KO
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Melanogenesis
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101073984
   04330 Notch signaling pathway
    101073984
   04350 TGF-beta signaling pathway
    101073984
   04630 Jak-STAT signaling pathway
    101073984
   04068 FoxO signaling pathway
    101073984
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101073984
  Cellular commiunity
   04520 Adherens junction
    101073984
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    101073984
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101073984
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101073984
Transcription factors [BR:tru03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101073984
Mitochondrial biogenesis [BR:tru03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101073984
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
17
AA seq 2150 aa AA seqDB search
MAENLLEMGPPSSKRPKLNSPALSASDGPDLGSLTWDDLENDLPDELIPNGGDLSLMSGM
PSNGGAASGPGGTPTGLGGGGSGVPDAAAKHKQLSELLRGGNSSSIASTGLNSANSQAGS
MGPQLGTPLGKSPLGQGSPNNHHSPQAQKAGTPSGVAGQNTNGNTAAMGLNSAGFNQTMI
NNGPSHGGLLPQGGQPQPGQMMNGGLGADAGRVRAAGVGVMQYQGASMQAAAAGAGGAAS
ALAETLTQGGQQMGAHTNLNGAQQAGSLNKMGLSSNGGPFGAQPYGQGATGPGQQLNQQQ
QLQNKVTLANSLPPFHNELKGAAVTNVPNMLQQPQQQAPMLPMAGSGSVAVTSAGPTADP
EKRKLIQQQLVLLLHAHKCQRREQANGEVRACALPHCRTMKNVLNHMTHCQAGKSCQVAH
CASSRQIISHWKNCTRHDCPVCLPLKNASDKRTQQPKLGSPNAGLQNSISSVGVGQPSPT
INTSTPIDPSSMQRAYAALGLPYSSQTTGQSQQGPGQQAGAQNSQAQQQQQLQQQMRPIN
ALGNQMALGGTAMGVTTSDQTNLHTDSVPNALNTNSQLLSDGSAVGSMGNLPTAAPMSAT
GTRKAWHEHVTQDLRSHLVHKLVQAIFPTPDPAALKDRRMENLVAYARKVEGDMYESANS
RDEYYHFLAEKIYKIQKELEEKRRSRLQKQIMNQAPLAVQGTQQPSLPQPNAFGARPQNG
PVPLPNMPNQIMNRMQVSQGMNQFNHMALPNAQISQAPMGARAASPMNHPQQMNLSAVPA
MGMSPSRMPQAQGMMAGHGAGNMVGQTNSQGQFLAQSQFPTGAAVNAAATMNVTVGSGMG
QSPAQAAVTQLSQPGASLENRVPTPASASSADLHTQHVGADLPTQEVKTDANHDQQDYEA
ACGKIEPKMEAEEDMVSVKKEEPEEKTESMEVEEKKPEPKEEDDAGANGTTSSSPSQSRR
KIFKPEELRQALMPTLESLYRQDPESLPFRQPVDPLLLGIPDYFDIVKNPIDLSTIKRKL
DTSQYQEPWQYVDDVWLMFNNAWLYNRKTSRVYKYCSKLAEVFESEIDPVMQGLGYCCGR
KYEFSPQTLCCYGKQLCTIPTGGTYYSYQNRYHFCEKCFNEIQGDSVTLGDDPAQPQTMI
SKDQFERKKNDVLDPEPFVECKDCGRKMHQICVLHYEVIWPSGFICKSCLKKSGKTRKEN
KFTAKRLQTTRLGMYIEDRVNKYLKRQNHPEAGEVFVRVVASSDKTVEVKPGMKARFVDT
GEMPETFPYRTKALFAFEEIDGVDVCFFGMHVQEYGSECAFPNTRRVYISYLDSIHFFRP
RILRTAVYHEILIGYLEYVKKLGYTQGHIWACPPSEGDDYIFHCHPPEQKIPKPKRLQEW
YRKMLDKAFAERILHDYKDIFKQATEDRLTSANELPYFEGDFWPNVLEESIKELEQEEEE
RKKEENTAASETPEGAQGDSKNAKKKNNKKTNKNKSSLSRANKKKPGMPNVANDLSQKLY
ATMEKHKEVFFVIHLHSGPMANTLPPIVDPDPLLSCDLMDGRDAFLTLARDKHWEFSSLR
RCKWSTMCMLVELHNQGQDRFVYTCNECKHHVETRWHCTVCEDFDLCISCYNTKGHEHQM
VKWGLGLDDDNNSQSGEASKSPQESRRLSIQRCIQSLVHACQCRNANCSLPSCQKMKRVV
QHTKGCKRKTNGGCPVCKQLIALCCYHAKHCQENKCPVPFCLNIKHKLRQQQMQHRLQQA
QLMKRRMATMQGRTMPLPSPPATAAPSTPTSHTQPNTPQTPQPPLSNQPQTPNSARVMSP
TFANAPRNGQPQAPVSQGKPGPQASPLHQQQSPLPQPPQAPQQLQQQPPPLAAVKMARHI
EMMAQAQQNYRANMNGLPMNPPQQQQRMPGPVQPSMQMVPGPRGAQVMQPGMTPGQWPGA
AGPIQAVQNPQGLVPGQTPQQPMTMQRAMMTPGQQPQQPARMLIPQQPGARPQTPQRPGT
IAPNALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYQANQPQQPGGQQQ
QPGMPTIQPMTMAGAVQRPGMPPQQPQQPSAQGMASLGAQTQLMNPAHNTGPQVQEMYRR
QLLRQQQQQQQQQQGVMPQGHPGQFPPQAQGTAATYSQLRMQQQQQQQQS
NT seq 6453 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaatctgctggagatgggacctcccagttccaagcggccgaagctgaattca
cctgccctgtcagcgtctgatggaccagatctggggtcacttacctgggatgatttggag
aacgatcttccggatgaattgatcccgaacggaggcgatctgagcttgatgagtggaatg
ccatcaaacggaggagcagcatccggtccaggaggaactccgacaggcctcggcggcggc
ggcagcggcgttcccgatgcagctgctaagcacaagcagctctcggagctccttcgaggg
ggtaacagctccagtattgcgagcacaggactgaactcagccaactcccaagcaggtagt
atggggccgcagctgggtacaccgctgggtaagagcccccttggccaaggctcccccaac
aaccaccattcaccccaggctcagaaagcaggaacaccaagtggagttgctggacagaac
accaacggtaatactgcagcgatgggtttgaactcagcgggatttaatcagacaatgatt
aataatggaccgagccacggcgggctcctcccgcagggcgggcaacctcaacctgggcag
atgatgaacggtggtcttggagccgatgctgggagagtacgagcggctggggtgggggtc
atgcagtaccagggagcgtcaatgcaggcagctgcagcaggagcgggaggagcagccagt
gcattggcagaaacacttacccagggagggcagcagatgggggctcacaccaatctcaat
ggtgcccagcaggcaggaagtctcaacaagatgggtctgagcagcaatgggggtccattt
ggggcccaaccctatggacagggtgctaccgggcctggccagcagctcaaccaacagcag
cagctacagaacaaggttacccttgcaaacagtttgccacctttccacaatgagctgaaa
ggtgctgctgtcactaacgtgccaaacatgctccagcagcctcaacagcaagcgcccatg
ctcccaatggctggcagcggcagtgtggcggtgacatcggcgggccccacagctgaccca
gagaaacgcaaattgatccagcagcagctggtcctgctgcttcatgcacacaagtgccag
cgccgggagcaggcgaacggcgaggtgagggcgtgcgctcttcctcactgccgcacaatg
aagaacgtcctcaaccacatgacccactgccaggctggcaagtcctgccaggtggctcat
tgtgcgtcatccagacagatcatttctcactggaaaaattgtacacgacatgactgtccc
gtctgcctgccgctgaagaatgccagtgacaaacgtactcagcaaccaaagctgggctcc
cctaatgcaggcctccagaactccatttcttcagttggtgtgggccagccaagtcccacc
attaatacctcaactcctatagacccctcctccatgcagagagcctacgcggcacttggg
ctgccgtacagcagccagacaaccgggcagagccagcagggcccaggacagcaagcaggt
gcacaaaattcacaagctcagcaacagcagcagcttcaacagcaaatgaggcccatcaat
gcacttggtaaccagatggctcttggaggcacagcaatgggtgtgaccacttcagaccag
acaaacctgcacacagattctgttcccaatgcactcaacactaacagtcagctgctgtca
gacggttcagctgtgggctcgatgggcaacctgcccactgcagcacccatgtcagccaca
ggcaccaggaaagcgtggcacgagcacgtcactcaggacctgcgaagtcaccttgtgcat
aaactggtacaagccatattcccaaccccagatccggcagctttgaaggacagaaggatg
gagaaccttgtagcgtatgccaggaaggtggaaggggacatgtacgagtcggctaacagt
cgtgatgaatactatcattttctggctgagaaaatctataagatccaaaaggaactggag
gagaagaggcgctccaggctacagaagcagataatgaaccaagcacctttggctgttcag
ggtacacaacagcccagccttccccaacctaatgcctttggcgcaaggccacagaatgga
cctgttcctttgcccaacatgccaaatcaaatcatgaatcgcatgcaagtttcacaagga
atgaaccagttcaaccacatggctctccccaatgcccagatctctcaggcaccaatggga
gcccgagctgcttcgcctatgaaccacccacagcaaatgaacctgagtgccgtcccagca
atgggcatgtccccatccaggatgccccaagcccagggcatgatggccggacatggggcc
ggtaacatggtaggtcagacaaacagccagggacagtttcttgcacagagccagttcccg
actggagctgcagttaatgcggcagcgactatgaatgtcactgtgggatctggcatgggc
caatcgcctgctcaagctgctgttactcagttgtctcagcctggagccagcctggaaaac
cgggtccctacaccagcctcggcatccagtgctgacttgcatactcagcatgttggagca
gacctaccaacccaggaggtcaaaaccgacgcaaaccatgaccaacaggactatgaggca
gcatgcggcaaaattgagcccaagatggaggctgaagaagacatggtatcggtaaagaag
gaggagccagaagaaaagactgagtctatggaggtggaggagaaaaagccagaaccgaag
gaagaggatgacgctggagctaatggcacaacttcctcatctccctctcagtcaagaagg
aaaatctttaagccagaggagttgcgtcaggcactaatgccaacgctggagtctctgtac
agacaagaccctgagtcactgcccttccgacagccagtagaccccttgcttctagggata
ccggactactttgacatcgtaaagaatccaatagacttgtccacaataaagcgcaaactc
gatacaagtcagtatcaagagccctggcagtacgtagatgatgtctggttgatgttcaac
aatgcttggttgtacaatcgcaagacatctcgtgtctacaagtactgttccaaactcgcc
gaggtgttcgagtctgaaatcgaccctgtgatgcagggtctgggatactgctgtggaagg
aagtatgagttctctccacaaactctctgttgctatggcaagcagctctgcaccataccc
actggaggcacatattatagctaccaaaacaggtatcatttctgtgaaaagtgcttcaat
gagatccagggagatagtgtgacattaggagacgatcctgcacagccacaaacgatgatc
tcaaaagatcagtttgaacgcaagaagaatgacgtactcgaccctgaaccgtttgttgaa
tgtaaagattgtggacggaagatgcaccaaatctgcgtcttacactacgaggtcatctgg
ccatctggattcatctgtaagagctgtttaaagaaaagtgggaaaacgcggaaggaaaac
aagttcactgcaaaacggctacagacaacacgactaggaatgtacattgaagaccgcgta
aataaatacttgaaaagacagaaccacccagaagctggagaggtgtttgtgcgagtggtg
gcgagctctgataaaacggttgaagtaaaaccgggcatgaaagccaggtttgtggacact
ggagaaatgcccgagacgtttccctacagaaccaaagcactttttgcctttgaggagatt
gatggtgtggacgtgtgcttctttggaatgcatgtccaggaatatggttcagagtgcgca
ttccccaacactaggcgggtctacatatcataccttgacagtattcacttctttagacct
cgcattctacggactgcagtataccatgagatcctcatcggatacttagaatatgtcaag
aaactcggatatacccaaggccacatctgggcatgtccacctagtgaaggagatgactat
atctttcactgccatccccctgaacagaagatcccgaagccaaagagactgcaggagtgg
taccggaagatgctggacaaggcttttgctgagagaattctgcatgactataaggacatc
ttcaaacaggcaacagaagatcgccttaccagtgctaatgagttgccgtactttgagggt
gacttctggcccaatgtgttggaagagagcatcaaggaattggaacaggaagaggaggag
cggaagaaggaagagaatacagctgcctctgaaactcccgagggtgcacaaggtgatagc
aaaaatgcaaaaaagaagaacaacaagaagaccaataagaataagagcagcctgagccga
gccaataagaagaagcctgggatgccgaatgtagccaatgatctatcccagaagctctac
gccaccatggagaagcacaaagaggtgttctttgtgatccacctccactctggacccatg
gccaatacgctgccccccattgttgaccctgaccctttgctctcttgtgacttgatggat
ggccgcgatgccttcctgacgctcgccagggacaaacattgggagttcagctcgctcaga
aggtgcaagtggagcaccatgtgcatgcttgtggagctgcacaaccagggccaggaccgc
ttcgtgtatacatgcaatgagtgcaaacaccacgtggagacacggtggcactgcactgtg
tgtgaggactttgatctgtgcattagctgttacaacacaaagggacatgagcaccaaatg
gtgaaatggggcctcggtctggatgatgacaacaacagtcagagtggtgaggcctccaag
agcccacaggagagccggcggttaagtatccagcgctgcatccagtccctcgtgcacgcg
tgtcagtgccgcaatgccaactgctctctgccgtcctgccaaaagatgaagcgagtggtg
cagcataccaagggttgcaagcgcaaaaccaatggcggctgccctgtatgcaagcagctg
atcgcgttatgctgttaccatgcaaagcactgtcaggagaacaaatgcccggtcccgttc
tgcctcaacatcaagcacaagctgcgtcagcagcagatgcagcacaggcttcagcaagcc
cagctgatgaagaggcgaatggccaccatgcaaggcagaaccatgccactgccgtcccca
cccgccacagccgcccccagcactcccacgtctcacacgcagccaaacactccccagacg
ccgcagccgccactctccaatcagccccagacaccaaattcagcaagggttatgtctcct
actttcgccaatgcgcctcgcaacggccagcctcaagcaccggtgtcgcagggcaagcct
ggaccccaggcatcgcctctacatcaacagcagtccccgctcccccagccaccccaagcc
cctcagcagctacagcagcagccgccccccctcgccgcggttaagatggcgcgtcatatt
gaaatgatggcgcaggctcagcagaactaccgggcaaacatgaatggccttcccatgaac
cctccacagcaacagcagcgcatgcccggaccagtacaaccatccatgcagatggtcccg
gggccaaggggggctcaagtcatgcaacctggcatgaccccgggacaatggccaggtgct
gcagggcctatacaggcagttcagaatccacagggccttgttcctggtcaaacaccacaa
caacccatgaccatgcagcgagccatgatgaccccaggccagcaacctcagcagcccgca
aggatgttaattcctcagcagcccggtgccaggccacagacgccccaaaggcctggtact
attgcacccaacgccctgcaggacctcctccgcaccctcaaatctcccagctcacctcag
cagcaacagcaagtccttaacatcctcaaatcaaatcctcagttaatggctgcattcatc
aaacagcgtacagccaaatatcaggccaaccaaccgcagcagcctggaggtcagcaacag
cagcccggcatgccgacaatacaacccatgactatggcaggggcagtgcagaggccagga
atgccgcctcagcagccccagcagccttctgcacagggcatggcttcgttaggggctcaa
acacagctgatgaacccagcgcacaacaccggaccccaggtgcaggagatgtaccgtcgc
cagctcttaagacagcagcagcagcagcagcagcagcagcaaggagtgatgccccagggc
caccctggtcagttcccacctcaggcacaggggactgcagcaacatactcccagcttcgc
atgcagcagcagcagcagcagcagcagagttag

DBGET integrated database retrieval system