KEGG   Takifugu rubripes (torafugu): 101074047Help
Entry
101074047         CDS       T02386                                 

Definition
histone-lysine N-methyltransferase SETDB2-like
Orthology
K11421  
histone-lysine N-methyltransferase SETDB [EC:2.1.1.43]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:tru00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 608 aa AA seqDB search
MEEDSLDPEDVERAKAFWKKEDIDDVFHVVFGYLGNLKRVLKKNTATDREYVQGLKLLEA
LNCSASGLNRDSSVVQVVIGSGELMVPEDSLSSPCSSPAAFSPNRDFSAAASPGDLLPPL
TPVQLHYRPHTCSKACLTTVPIMPQSVPLFWGQNPLKIPLLCGFKRLTARLPLTEGAELE
DSEDSLDGDVIYKTPCGLSLRNYDDVMSFLLDTESYDILQVDFFTYNPFIQLDPPPSDRH
QLPELDLSRGIEPTPVELCLGEGGAKPPNFRYRKDRWPHGCFLSRSLKLFSTCCDCVDGC
SDAKQCACVAMTKEGRHYSHQRLEEPISSGVYECGPWCGCDRARCQNRLVQRGIRVRLQV
FQTDNCGWGVRCRDDLDRGMFVCTYAGVILQRAQSSITPPSPKLPRIELPSDDEVQVVTE
WLVPSQEDGKSAVMEGSSPPLHVPVIQRPADAKTPQDRDKKGPPGGQQPAATLAAMSDEP
TSDQRSVCRSNGSEMEKKNMKSLKRVLTDVDTIIVDASKEGNVGRFFNHSCKPNLFLQNV
FTDSHDLAFPVIAFFTSRVVKAGTELTWDYSTHVKRKQEVPCLCGSRDCTGHFAIEEKLC
EMCEAEAQ
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagactctttagatccagaagatgttgagcgagccaaagcattttggaagaag
gaggatattgatgacgtgtttcatgttgtatttgggtatctgggtaatctgaaaagggtt
ctgaagaaaaacacagccacagatcgagaatatgttcagggcttaaagctgctggaggct
ttgaactgttcagcgtccggtttaaatcgggactcttctgtggttcaggtggtcatcggt
tcaggtgaacttatggtgcctgaggactctttatccagcccctgctcctcccctgctgcc
ttctccccaaatagagactttagtgctgcagcttcccctggtgaccttctgcctcctcta
acacctgttcagttgcattacaggccccacacttgcagcaaggcttgcttgaccacagta
cccatcatgcctcagtctgtgccactgttttggggtcagaacccactaaagattccgttg
ctctgcggctttaagaggctgaccgccagactgccactcactgagggggcagagttggag
gactcggaggattcgttggatggggacgtcatttacaaaacaccctgtggcctgagtctc
cgtaactatgacgatgtgatgtctttcctgttggacacagagagttatgacatcctgcag
gttgacttcttcacctataacccattcattcagttggacccacccccgtcagacaggcac
cagttgccagagcttgacttgagccgcggcatcgagccgacacctgtggagctgtgtctg
ggtgaaggtggtgcaaaaccacccaactttcgctacaggaaagaccgatggccgcacggc
tgcttcctaagccgcagtctgaaattattcagcacctgttgcgactgtgttgatggctgc
agcgacgcaaagcagtgcgcctgtgttgccatgacgaaggaggggcgccattacagccac
caaaggctggaagaacccatctcatcgggtgtgtatgagtgtggaccgtggtgcggctgt
gaccgagctcgctgtcagaaccgtctggtccagagagggatcagggtacgtcttcaggtc
ttccagactgacaactgtggctggggcgtgcgctgccgtgatgacctggaccgcgggatg
tttgtgtgcacatatgcaggtgtgatcctgcaaagggcccaaagttccatcacacccccg
tccccgaagctgccgaggatagaactcccctctgatgatgaagtacaggtagttacagag
tggctggtcccctcgcaggaggatggcaaaagtgctgtgatggaaggctcgtcgcctcct
ctgcacgtcccagtgatccagagacctgctgacgccaaaacaccgcaggacagagacaag
aaggggccacctgggggccagcagcctgctgctactttagcagctatgtcggatgagccc
acgtcagatcagaggtctgtctgcagatccaacggtagcgaaatggagaaaaaaaacatg
aagtctttaaagagagtcttgacagatgtggacaccatcattgtggatgccagcaaagaa
gggaacgtcggccgcttttttaaccacagctgcaagccgaacctcttcctccagaacgtc
ttcacagactcccatgacctggccttccccgtcatcgccttcttcaccagcagagttgtg
aaggctggcaccgagcttacctgggattactccacccatgtcaagcggaaacaggaggtg
ccttgcctttgcgggtctagagattgtactggacactttgccattgaggaaaagctgtgt
gagatgtgtgaagctgaggcacagtaa

DBGET integrated database retrieval system