KEGG   Takifugu rubripes (torafugu): 101074047Help
Entry
101074047         CDS       T02386                                 

Gene name
setdb2
Definition
(RefSeq) SET domain, bifurcated 2
  KO
K18494  
histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101074047 (setdb2)
Enzymes [BR:tru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101074047 (setdb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 610 aa AA seqDB search
MEMEEDSLDPEDVERAKAFWKKEDIDDVFHVVFGYLGNLKRVLKKNTATDREYVQGLKLL
EALNCSASGLNRDSSVVQVVIGSGELMVPEDSLSSPCSSPAAFSPNRDFSAAASPGDLLP
PLTPVQLHYRPHTCSKACLTTVPIMPQSVPLFWGQNPLKIPLLCGFKRLTARLPLTEGAE
LEDSEDSLDGDVIYKTPCGLSLRNYDDVMSFLLDTESYDILQVDFFTYNPFIQLDPPPSD
RHQLPELDLSRGIEPTPVELCLGEGGAKPPNFRYRKDRWPHGCFLSRSLKLFSTCCDCVD
GCSDAKQCACVAMTKEGRHYSHQRLEEPISSGVYECGPWCGCDRARCQNRLVQRGIRVRL
QVFQTDNCGWGVRCRDDLDRGMFVCTYAGVILQRAQSSITPPSPKLPRIELPSDDEVQVV
TEWLVPSQEDGKSAVMEGSSPPLHVPVIQRPADAKTPQDRDKKGPPGGQQPAATLAAMSD
EPTSDQRSVCRSNGSEMEKKNMKSLKRVLTDVDTIIVDASKEGNVGRFFNHSCKPNLFLQ
NVFTDSHDLAFPVIAFFTSRVVKAGTELTWDYSTHVKRKQEVPCLCGSRDCTGHFAIEEK
LCEMCEAEAQ
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atggagatggaagaagactctttagatccagaagatgttgagcgagccaaagcattttgg
aagaaggaggatattgatgacgtgtttcatgttgtatttgggtatctgggtaatctgaaa
agggttctgaagaaaaacacagccacagatcgagaatatgttcagggcttaaagctgctg
gaggctttgaactgttcagcgtccggtttaaatcgggactcttctgtggttcaggtggtc
atcggttcaggtgaacttatggtgcctgaggactctttatccagcccctgctcctcccct
gctgccttctccccaaatagagactttagtgctgcagcttcccctggtgaccttctgcct
cctctaacacctgttcagttgcattacaggccccacacttgcagcaaggcttgcttgacc
acagtacccatcatgcctcagtctgtgccactgttttggggtcagaacccactaaagatt
ccgttgctctgcggctttaagaggctgaccgccagactgccactcactgagggggcagag
ttggaggactcggaggattcgttggatggggacgtcatttacaaaacaccctgtggcctg
agtctccgtaactatgacgatgtgatgtctttcctgttggacacagagagttatgacatc
ctgcaggttgacttcttcacctataacccattcattcagttggacccacccccgtcagac
aggcaccagttgccagagcttgacttgagccgcggcatcgagccgacacctgtggagctg
tgtctgggtgaaggtggtgcaaaaccacccaactttcgctacaggaaagaccgatggccg
cacggctgcttcctaagccgcagtctgaaattattcagcacctgttgcgactgtgttgat
ggctgcagcgacgcaaagcagtgcgcctgtgttgccatgacgaaggaggggcgccattac
agccaccaaaggctggaagaacccatctcatcgggtgtgtatgagtgtggaccgtggtgc
ggctgtgaccgagctcgctgtcagaaccgtctggtccagagagggatcagggtacgtctt
caggtcttccagactgacaactgtggctggggcgtgcgctgccgtgatgacctggaccgc
gggatgtttgtgtgcacatatgcaggtgtgatcctgcaaagggcccaaagttccatcaca
cccccgtccccgaagctgccgaggatagaactcccctctgatgatgaagtacaggtagtt
acagagtggctggtcccctcgcaggaggatggcaaaagtgctgtgatggaaggctcgtcg
cctcctctgcacgtcccagtgatccagagacctgctgacgccaaaacaccgcaggacaga
gacaagaaggggccacctgggggccagcagcctgctgctactttagcagctatgtcggat
gagcccacgtcagatcagaggtctgtctgcagatccaacggtagcgaaatggagaaaaaa
aacatgaagtctttaaagagagtcttgacagatgtggacaccatcattgtggatgccagc
aaagaagggaacgtcggccgcttttttaaccacagctgcaagccgaacctcttcctccag
aacgtcttcacagactcccatgacctggccttccccgtcatcgccttcttcaccagcaga
gttgtgaaggctggcaccgagcttacctgggattactccacccatgtcaagcggaaacag
gaggtgccttgcctttgcgggtctagagattgtactggacactttgccattgaggaaaag
ctgtgtgagatgtgtgaagctgaggcacagtaa

DBGET integrated database retrieval system