KEGG   Takifugu rubripes (torafugu): 101074089Help
Entry
101074089         CDS       T02386                                 

Definition
galactocerebrosidase-like
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tru00600]
Cellular Processes; Transport and catabolism; Lysosome [PATH:tru04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 664 aa AA seqDB search
MGSRLLPGLLVVISLPLCSCQAYYLSDKAGLGRVFDGIGGLSGGGATSRLLVNYAEPYRS
QILDYLFKPNFGASLHILKVEIGGDAQSTDGTEPSHMHYEADENYFRGYEWWLMKEAKKR
NPNITLIGLPWAFPGWVGHGNDWPYDFPDITAAYVVNWIIGAKQYHDLDIQYIGIWNERS
FDIKYIKLLRYTLDKSGLEEVKIIASDNLWQPITRSLLLDAELHRAVDIIGAHYPGTNTV
MEALETRKTLWSSEDYSTFNDDVGGGCWARILNQNYVNGFMTATISWNLVASYYDNLPFS
RDGLMTAEEPWSGNYVVESPIWITAHHTQFTQPGWTYLQTVGHLAQGGSYVALTDGKGNL
TIVIETMTHDHSVCIRPPLPAFNVTSQTAMFQLEGSFASISEVQVWRSHFGFKSKKPSFF
ERLTPLKLVDGFFSLHLMEDEVYTLTTLKVGQKGSYPSPPASSPFPKVYKDDFNVRHPSF
SEAPYFADQTGVFEYFMNLSDPGPHLYTLRQVITERPVTWVADADQTISVIGDYQWQNLT
VTCDVFMETATTGGVFLAARVDRGGQAVRSTRGVFFWLFADGTYRVTNDLAGQTVLAEGE
SGTRAYRWYTLTLTVQGQYASGQLNGYQLWSNAVVLTPKNGWVAIGTRSFESNQFDNIAI
VAKG
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcagattactccctggacttcttgtcgtcatctctctgccgttatgctcctgc
caggcgtattacttgagcgacaaagcggggctggggagagtctttgacgggattggaggt
ttaagcggcggaggggcaacctctcgattactggtcaattatgccgagccataccggagc
cagatattagactacctgtttaagccaaacttcggagcttctttgcacattttgaaagtg
gagattggaggagatgctcagagtacggatggaacagaaccctcacacatgcattatgaa
gctgacgagaactattttcgaggatatgagtggtggctgatgaaagaggccaagaagagg
aacccaaatatcacattgataggtttaccctgggcgtttcctggctgggtgggccatggt
aacgactggccctacgatttcccagacatcactgcagcatatgtggtgaactggatcatt
ggggccaaacagtaccatgacctggacatccagtatattgggatatggaatgagcgaagc
tttgacatcaaatacattaagctgctgcgatacactctggataaaagtggattggaggag
gtgaaaatcattgccagtgacaacctgtggcagccgatcacgcggtctctcctgctggac
gctgagctccacagggctgtagatatcataggtgcccactacccaggtaccaacacagtg
atggaggcactggagacacggaagacactgtggtcctccgaagattacagcactttcaac
gatgatgtggggggaggctgctgggctcgcattctaaaccagaactatgtcaatggcttc
atgactgccaccatctcctggaacctggtggccagctactacgacaacctgccattcagc
agagatgggctgatgacggcggaagagccctggagcggcaactatgtcgtggagtctccc
atctggatcacggcccatcacacacagttcacccagccgggatggacctacctacagact
gttggacatctggcacaaggtgggagctatgtagccttgactgacggcaaaggaaacctc
actattgtcattgaaactatgactcatgaccattcggtctgcatcagaccaccactgcct
gccttcaacgtgacatctcagaccgcgatgttccagctggagggatcctttgcctccata
agtgaagtccaggtatggcgctcgcactttggttttaaaagcaaaaagccgtccttcttt
gagaggctgactcctctgaagctggtggatgggttcttcagcttgcatttaatggaagat
gaggtttacacgctaaccacactgaaagtgggacagaagggcagctacccaagcccacct
gcctcctctcccttccccaaagtctacaaggatgactttaacgtccgacacccctccttc
tctgaggctccatactttgcggaccagactggagtgtttgaatacttcatgaacctgagt
gaccctggacctcacctctacaccctgagacaggtcataaccgagagaccggtcacgtgg
gtcgctgatgcggaccagaccatcagtgtcataggagactaccagtggcagaacctcacg
gtcacctgtgatgtcttcatggagacggccacgaccggcggcgtattcctcgctgctaga
gtggacagaggcggccaggctgtccgctccactagaggagtctttttctggctgtttgct
gatggcacgtacagagtgacgaatgatttagctggacagactgtacttgcagaaggagag
tctggcacccgagcctacaggtggtacaccctcacgctcactgtccaaggccagtatgca
tcgggtcagttgaacggataccagctgtggagcaatgctgtggtactgacacccaaaaat
ggctgggttgccataggaacacggtcatttgaatcaaatcagtttgataatattgcaatt
gtggccaaaggataa

DBGET integrated database retrieval system