KEGG   Takifugu rubripes (torafugu): 101074108Help
Entry
101074108         CDS       T02386                                 

Definition
laminin subunit beta-2-like
Orthology
K06243  
laminin, beta 2
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Focal adhesion
ECM-receptor interaction
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:tru04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:tru04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 1778 aa AA seqDB search
MISSLALAVVAAALGQEPDPSHVCAHGSCYPATGDLLVGREKNLKASSTCGLRRKERYCI
VSHLQDEKKCFDCDSRRPYDPVYNTINHRIENVITTFKPHRKNSWWQSENGKSEVFIQLN
LDAEFHFTHLIMTFKTFRPAAMLIERSADFGRTWQIYRYFSHDCSSNFPGVSQGPLRKIN
DIICESRYSDIEPSTEGELIYKVLDPSITIKDPYSPTIQNLLKITNLRVNFTRLHTLGDN
LLDPRPEIKEKYYYAIYELVVRGNCFCYGHASECAPINGIRDDIDGMVHGRCVCNHNTKG
LNCEQCDDFYNDLPWMPAEGHNTNACRKCNCNGHSNICHFDMAVYLASGNISGGVCDDCQ
HNTMGYQCDMCKPFYYKDPAKDIRDPHVCVACDCDPDGSQNGGMCDSHTDTSLGLVGGQC
RCKVNVDGPRCDKCKTGFFGLSADNPQGCQPCQCDRMGTVLGNSQCDPVSGDCFCKRLVT
GRSCDKCLPEHWALSHDLNGCRACDCDVGGALDNLCSKETGQCRCRSHMTGRQCSQVDSG
YFFMALDYFLYEAELAKMGQSCTVETREHQAGRLATWTGVGFARVPEGGTLDFHISNIPY
SMEYDLLIRYESQMPRDWEEVRITVIRPGPIPTSSPCGNTIPDDDRLTVLLPSGTRFMVP
SHPVCLERGVTYTLRFEFTRYQDVNSVLNGAANAILFVDSISLIPRHSSMEMFNAGDPTA
NSRKQNYERYRCHDSAKTVSRNLMSNTCSKLISSMSAIIHDGALPCNCDPQGSSSSVCDV
RGGQCHCRPNVIGRRCDQCAWGTYGFGPSGCTACGCSLEGSVTRLCDRYTGQCQCHPGAF
GRYCDACKAGHWGFPTCRPCQCNGHTDECDQRTGACIRCRDNTGGDKCERCADGYYGNPA
SGLCHPCPCPDGPNSGRHFAATCYQDIQSRQIICNCNQGYIGARCGGCAPGYHGNPSQPS
GRCQPCQCNNNIDMTDMAACDRRTGECRKCLYNSEGPTCGICKSGYFGDASQRNCRKCVC
NFLGTDRSQCMDNEDCVCQRATGQCQCLQNVIGLTCDHCAPNHWNLAGGRGCEPCGCDPN
NSVSSSCNEFTGQCQCRSGFGGKTCTDCEENYWGDPRTQCRACDCDPRGIDTTQCNRVTG
HCVCLQGVSGVRCDQCARGFSGHFPNCQPCHQCFGDWDRIVQDLAGRTKALAQRAHEIQN
TGLTGAYEKFFRNLEDKLAQAQGIVNVRNATASAVAILMELIEDLRAQISEATDTLNHLE
GDLTMVQDSNSEASKELSALEREARELNLTSEQLHSQLDILKNSNFLGAFDSILSSYNRS
RDAERCANESVITKSSIVVQSANTRYRTQRLMTLKKDDFNQKNAANKRTLGDFRNRLQGL
DMKKVNEKICGTPNDAPCGESPCGGAGCRDDDGNPHCGGLNCNGAVAAADNALERGKHAE
KELNKAMREVEGLYIKVVEVKSKAEEAKGKAQAALDKATATKKNIERSNKDLRDLIKQIR
DFLTQEEADPDSIEVVANRVLELSIPASSLQIKHLADEIKGKVQSLSNVDAILQKTKDDV
RKAEQLLLNAKTVRHHAEKVKATTEAVKEALLNCKTAQASAEKAILTAKVDIMDTETRLA
QIESVTSNSENDLNVAIRHLETLGRDINALKTKCANNSMAAARAEETATMARDKANEAKQ
ILDGQLTDKYHEVQQRVGTKVKALMDAKKRAESLRNEATNLLKDAQHKLQMLTELEKSYE
ENQRKMEGKAHQLDGLEDKMKSILNDINKQIQIYNTCQ
NT seq 5337 nt NT seq  +upstreamnt  +downstreamnt
atgatttccagtttggctttggcagttgtggctgctgctcttggccaggagcctgacccc
agtcacgtttgcgcccatggcagctgctacccagcaacaggagatctgcttgttggtcga
gagaaaaacctgaaggcctcatccacctgtgggctgaggaggaaagagcgctactgcatc
gtcagtcatctgcaggatgaaaagaaatgttttgattgcgattcgcgacggccatatgat
ccggtgtataacaccatcaatcatcggatagagaatgtcatcaccacctttaaacctcac
cgtaaaaactcctggtggcagtctgaaaatggaaagtcggaggtttttatccagctgaat
ctggatgctgagtttcattttactcacttgataatgactttcaagactttccgtccagca
gctatgctgattgaacgttcagcagatttcggccgaacttggcaaatctaccgttacttt
tcccatgactgttccagtaactttcctggagtgtcccaaggtcctttgcgcaaaataaat
gatatcatctgtgaatcgcgctactctgatatcgaaccatcaacagagggagagttaatt
tacaaagtcttggatccgtccatcacgattaaagatccttacagcccgaccatccaaaac
ctgctaaagatcaccaacttgagggtgaacttcacaaggcttcacacactgggagacaat
ttacttgaccccagaccagaaattaaagaaaagtattattatgctatctatgagctggtt
gtgcgtggcaactgcttctgctatggccacgcctctgagtgtgctcccatcaatggcatc
agagatgatatagatgggatggtccatggcaggtgtgtgtgcaaccataacaccaagggt
ttaaactgtgaacaatgtgatgacttctacaatgacttgccctggatgccagctgaagga
cacaatactaatgcctgcaggaagtgtaactgtaatggccactccaacatttgccacttt
gatatggctgtgtatttggcctctggaaatatcagtggaggagtgtgtgacgactgccag
cacaacaccatgggctaccagtgtgacatgtgcaaaccgttctactataaagaccctgcg
aaggatatcagagaccctcacgtgtgcgtagcctgtgactgtgaccccgatggttcccag
aacggaggtatgtgcgacagccataccgacacatctctgggcttggtgggtggccaatgc
cgctgcaaagttaatgttgatggaccacgctgtgacaagtgtaagacgggcttttttggt
ctaagtgcagacaacccccagggctgccaaccttgtcagtgtgaccgaatgggaactgtg
ctgggtaattcccagtgtgacccagtcagcggagactgcttctgcaagcgccttgtcact
ggacgcagttgcgacaagtgtttgccagaacactgggcgctgagtcatgatctgaatggc
tgcagagcctgtgactgtgatgtcggaggagcattggacaacctttgctcaaaggagact
gggcagtgtcgctgccgcagtcacatgactggacgtcagtgttcacaggtagattcagga
tatttcttcatggccctggattactttctttacgaggctgagctggccaaaatgggccag
agctgtacagtggagacgagggagcaccaggcaggtcgtcttgccacgtggacaggtgtc
gggtttgctcgggtgcccgaaggcggaaccctggactttcacatctctaacattccctac
tccatggaatatgacctactgatccgctatgagtcacagatgccgcgagactgggaagaa
gtgaggatcacagtgatccggccagggccgattcctaccagcagcccctgtggaaacacc
atcccagatgatgacagactcactgtccttttgccttctggaaccaggtttatggtcccc
tctcacccagtatgtcttgagaggggtgtgacttacacccttcgctttgagttcacacgc
tatcaggatgtgaacagcgttctcaacggagcagccaatgctatcctatttgtggactct
atttccttgataccacgacactccagcatggagatgttcaatgcaggggatccaacagct
aacagcagaaagcagaactatgagcgctatcgctgccatgacagtgcaaagactgtgagc
cgcaacctgatgagcaacacctgcagcaagctgatcagcagcatgtccgctatcatccat
gatggggcactgccttgtaactgcgacccacaaggatcgagcagctctgtgtgcgatgtt
cgtgggggccagtgtcactgcagacccaacgtgattggccgacgctgtgaccagtgcgcc
tggggaacttatggctttggaccgtcaggctgtacagcctgtggctgcagcttggaagga
tccgtgactcgactttgtgacaggtacacaggccagtgccagtgtcatccaggagcattt
ggcaggtattgtgatgcatgcaaggcaggtcactggggtttccctacctgccgtccatgc
caatgtaatggacacactgatgagtgtgaccagaggaccggagcctgtatcaggtgcagg
gacaacactggaggggacaagtgtgaaaggtgtgctgatggctactatggaaatccagct
tctggactttgccatccatgtccttgtcccgatgggcccaacagtggacgtcactttgct
gcaacgtgttaccaggacatccaaagcagacaaatcatctgcaactgcaatcagggttac
ataggggctcgatgtgggggatgtgctccaggttaccatggtaacccatctcagccttct
gggcgctgccaaccatgccagtgcaataataacatcgacatgaccgacatggctgcttgt
gacagacgcactggcgagtgcaggaagtgcctgtacaacagcgaaggccccacatgcggc
atctgcaagagcggctattttggagatgcttcccaacgcaattgcaggaagtgcgtttgt
aattttttgggtaccgaccgcagccaatgtatggacaacgaggactgtgtgtgccaacgt
gccacagggcaatgccagtgtctacaaaatgtcataggtctgacatgtgaccactgtgcc
cctaaccactggaacctggccggtggcaggggctgtgagccctgtggctgtgatccaaac
aactcagtctcgtcctcatgtaatgagttcactgggcagtgtcaatgtcgtagtggcttt
ggaggaaagacctgcactgactgtgaggaaaactactggggagacccaaggacacagtgt
agagcctgtgactgtgacccgcggggcatcgacaccacacagtgcaaccgcgtgaccggc
cactgtgtttgcctgcaaggggtgtcaggtgtccgttgtgaccagtgtgccagagggttc
tctggccattttcccaactgtcaaccctgtcaccaatgtttcggggactgggatcgcatt
gtacaggacttagcagggcgtaccaaggctctagcacagcgtgctcatgagattcagaac
actggactcactggggcctatgagaagtttttcagaaatctagaagacaaattagcacag
gctcagggcattgtgaatgtgcgcaatgccactgcttcagctgttgctattctaatggaa
cttattgaagatcttagagcacaaattagtgaggcaactgacaccctgaaccatctggaa
ggagacctgactatggtccaagacagtaactctgaggcaagcaaagagctgagcgctctg
gagagagaggccagagaactcaatctaacatctgaacagctacattcccaactggatatc
ctcaaaaattctaacttccttggtgcgtttgacagcatacttagctcctataaccggtcg
cgtgatgcggagaggtgcgctaatgaatcagtaatcactaagtccagcatagtggtccag
tccgcaaacactcggtatcgcacccagcggcttatgaccctgaagaaggatgacttcaat
caaaagaatgccgcaaacaagcgcacactgggagacttcagaaacagactgcagggcctg
gacatgaagaaagtcaatgaaaaaatttgtggcactccaaatgatgctccctgtggggag
agtccgtgtggaggtgccggttgccgtgatgatgatggaaaccctcattgtggaggccta
aattgtaatggcgccgtagcagcggcagacaatgccttggagagaggaaaacatgccgag
aaggaacttaacaaagccatgcgagaggttgaaggactctatatcaaggtggtggaagtc
aagagcaaggcagaggaagccaagggcaaagctcaagcagcgctggacaaagccactgca
accaagaaaaacatcgagcgctccaacaaagacctgagagatttgatcaaacaaatcagg
gattttctcacccaagaggaggcagatccagacagtattgaagtagtagcaaaccgtgtg
ttggagctctccatacctgcctcctcccttcagatcaaacatcttgcagatgaaatcaag
ggaaaagtccagagcctttccaacgtggatgctatcttacagaagacaaaggatgacgtc
cgcaaggcagaacaactcttactgaatgccaagactgtaaggcatcacgctgagaaagtg
aaggccacaacagaggcggtgaaagaggccttgttgaattgtaagactgcccaagcatca
gcagaaaaggccattctgacagcaaaagttgacattatggacactgaaacccgactagca
caaattgagtcagtgacctcaaacagtgagaacgatctaaatgttgccattcgccatctg
gaaacactggggagagacattaatgccctgaagaccaaatgtgccaacaacagcatggca
gcagcgcgagctgaggaaacggccacaatggcacgagacaaggctaacgaagccaagcag
attctagatgggcagctgacagataagtaccatgaggtacagcagcgagttggtacaaag
gtgaaagcgctaatggatgctaagaagagggcagagagtctcagaaatgaggctacaaac
ctgctcaaagacgcccagcataagctccagatgctgacagaactggagaagagctatgag
gaaaaccagaggaagatggaggggaaagctcatcagctggatggcttggaggacaagatg
aagtccatcctcaatgacatcaacaaacaaatccagatctacaatacatgccagtaa

DBGET integrated database retrieval system