KEGG   Takifugu rubripes (torafugu): 101074110Help
Entry
101074110         CDS       T02386                                 

Gene name
ppp3r1
Definition
(RefSeq) protein phosphatase 3, regulatory subunit B, alpha
  KO
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Wnt signaling pathway
VEGF signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101074110 (ppp3r1)
   04310 Wnt signaling pathway
    101074110 (ppp3r1)
   04370 VEGF signaling pathway
    101074110 (ppp3r1)
   04020 Calcium signaling pathway
    101074110 (ppp3r1)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    101074110 (ppp3r1)
   04210 Apoptosis
    101074110 (ppp3r1)
Protein phosphatases and associated proteins [BR:tru01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     101074110 (ppp3r1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 170 aa AA seqDB search
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID
IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV
GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgaagccagttaccccctggagatgtgctcgcattttgatgctgatgagatt
aagaggctagggaagaggtttaagaaactcgacctagataattctggctccctcagtgtg
gaggagttcatgtcgctgccagagctccaacagaacccgctggtgcaaagggtcatcgac
atatttgacacggatgggaatggagaagtagactttaaagagttcattgagggagtctcg
caattcagtgtcaaaggagacaaggaacagaagcttcgatttgctttcaggatttatgac
atggacaaagacggctacatttccaacggagagctcttccaggtgctgaagatgatggtg
ggcaacaacctgaaggacacgcagcttcagcagatcgtagataagactattattaatgca
gacaaggacggagatggcaggatatccttcgaagagttctgtgcagtggtcggtggtctt
gatatacacaaaaagatggtggtggatgtgtga

DBGET integrated database retrieval system