KEGG   Takifugu rubripes (torafugu): 101074110Help
Entry
101074110         CDS       T02386                                 

Definition
calcineurin subunit B type 1-like
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Wnt signaling pathway
VEGF signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tru04010]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:tru04310]
Environmental Information Processing; Signal transduction; VEGF signaling pathway [PATH:tru04370]
Environmental Information Processing; Signal transduction; Calcium signaling pathway [PATH:tru04020]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:tru04114]
Cellular Processes; Cell growth and death; Apoptosis [PATH:tru04210]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 198 aa AA seqDB search
MTSSESFLGIFAGESSRSCSCMVVQRLAQGNEASYPLEMCSHFDADEIKRLGKRFKKLDL
DNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKL
RFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEE
FCAVVGGLDIHKKMVVDV
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcgtcagagtcgtttctgggaatctttgcaggcgaatctagcaggtcctgcagc
tgcatggtggtgcagaggttggcacagggaaatgaagccagttaccccctggagatgtgc
tcgcattttgatgctgatgagattaagaggctagggaagaggtttaagaaactcgaccta
gataattctggctccctcagtgtggaggagttcatgtcgctgccagagctccaacagaac
ccgctggtgcaaagggtcatcgacatatttgacacggatgggaatggagaagtagacttt
aaagagttcattgagggagtctcgcaattcagtgtcaaaggagacaaggaacagaagctt
cgatttgctttcaggatttatgacatggacaaagacggctacatttccaacggagagctc
ttccaggtgctgaagatgatggtgggcaacaacctgaaggacacgcagcttcagcagatc
gtagataagactattattaatgcagacaaggacggagatggcaggatatccttcgaagag
ttctgtgcagtggtcggtggtcttgatatacacaaaaagatggtggtggatgtgtga

DBGET integrated database retrieval system