KEGG   Takifugu rubripes (torafugu): 101074144Help
Entry
101074144         CDS       T02386                                 

Definition
ubiquitin carboxyl-terminal hydrolase 49-like
Orthology
K11834  
ubiquitin carboxyl-terminal hydrolase 44/49 [EC:3.1.2.15]
Organism
tru  Takifugu rubripes (torafugu)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 670 aa AA seqDB search
MDRCKHVGRLRLGHDHSILNPQKWQCVDCSTTDSVWACLKCSHVACGRFMEEHSLKHFQE
SRHPLAMEVRELDVFCFACGDYVLNDNAEGDLKLLRGALSTVRRPGTRSLRSSAGGDCTP
WVGEGGPAMQLALRHRRKALLRKTLQTWFDKHQALQKERREKLEEARQQKKDVKRRLLEE
LGNVPPRKSARLLTQAPRSTITLIPSKFRDPPERLPPPPKKPSLLSLSRKAPRSSRAAKL
RRYYSAHSVSRRRLAPGVTGLRNLGNTCYMNSILQVLSHLRKFRECFLTLDLCETEELLA
KSNHTQGVKGVTGAVVSNGNTALSGCPLGRIGNLPVGRKESAPPSTQAAELVQAKASRCS
TRQQMSLCYELHTLFRVMWSGRWSLVSPFAMLHSVWNLIPAFRGYDQQDAQEFLCELLDK
VQQELDTEGSRRRIVIPITKRKLSKQVLKVLNTIFHGQLLSQVTCLSCKHKSNTVEPFWD
LSLEFPERYHSVKGSGSSSAYQRSCTLTEMLSKFTEMEALEGNIYACNHCNKKRRKSSHK
PLVLSEACKQLLIYRLPQVLRLHLKRFRWSGRNHREKIGVHVAFDQVLNIKPYCCTGSGH
SVHRGGYTYDLSAVVMHHGKGFGSGHYTAYCYNTEGGFWVHCNDSEMKVCSVEEVCNTQA
YILFYTQRSA
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atggatcgctgtaagcacgtgggacgcctccgcctgggccacgaccattccatcctcaac
ccgcagaaatggcagtgtgtggactgcagcaccaccgactcggtgtgggcctgcctcaag
tgctcccacgtggcgtgcgggcgtttcatggaggagcactcgctcaagcacttccaggag
tcccgccacccgctggccatggaggtgcgcgagctggacgtgttctgcttcgcctgcggg
gactacgtgctcaacgataacgccgaaggtgacctgaagctcctccggggggcgctctcc
accgtgcgccgcccgggcacgcgttcgctgcgctcctccgccggcggggattgcaccccc
tgggtcggggaaggcgggcccgccatgcagctggccctgcgccaccggaggaaagcgctg
ctccggaagacgctccagacgtggttcgacaagcaccaggcgctgcagaaggagcgcaga
gagaagctggaggaagccaggcagcagaagaaagacgtgaagaggcgactcctggaggag
ctgggcaacgtgcctcccaggaagagcgcccggctcctcactcaggcaccacgctccacc
atcacactcattcccagcaaattccgcgacccgccggaacgcctacctcctcctcccaag
aagccttccctcctgtccctgtcccgcaaagctcctcggagtagcagggcggccaaactg
aggaggtactactccgctcactcggtgagccgccggcgactcgctccgggcgtcactggc
ctgcgcaacttagggaacacgtgctacatgaactcgatattgcaagtgctgagccacctg
cggaaattcagggagtgttttctcaccttggacctatgtgagaccgaggagctgctggcc
aaatccaatcacacccagggcgtgaagggcgtgacgggcgcggtggtcagcaacgggaac
acggctctgtcgggatgccctctgggacgcatagggaatttgcccgtgggcaggaaagag
agcgccccgccttccacgcaggcggcggagctggtgcaggccaaggcgtcccgctgctcc
acccgccagcagatgtctctttgctatgaactccacacgcttttcagggtcatgtggtca
ggccgctggtctttagtgtcccccttcgccatgctgcactcggtgtggaacctcatcccg
gctttccgtgggtacgaccagcaggacgctcaggagttcctgtgtgagctgctggacaag
gtgcagcaggagctggacacggaggggtccaggcgcaggatcgtcatccccatcaccaaa
cggaagctctccaagcaggtgttgaaggtcctcaacaccatctttcacggacagttactc
agccaggtgacgtgtctctcctgcaagcacaagtctaacactgtggagccattctgggat
ttgtctttggagtttccggaacgataccacagcgtcaaaggctcgggctcctcctcagcg
taccagcgcagctgcaccctcaccgagatgctgtccaagtttacagagatggaggctctt
gaaggcaacatctatgcctgcaaccactgtaacaaaaagaggcgaaaatcttcccacaaa
cctttagtcctgtcagaggcgtgtaagcagcttctgatctaccgtttacctcaggttcta
cggctgcacctcaaacgcttcagatggtcggggcgaaaccatcgggagaaaatcggcgtc
cacgtggccttcgaccaagttctgaacatcaaaccatactgctgcacaggctcaggtcac
tccgtccacagaggaggctacacctacgatctgtcggccgtcgttatgcatcacgggaaa
ggcttcggctcagggcactacacggcatactgctacaacacagaaggaggattctgggtc
cactgtaacgactctgagatgaaggtttgcagcgtggaggaagtgtgtaacactcaggcc
tatattctcttctacacccagaggtccgcctag

DBGET integrated database retrieval system