KEGG   Takifugu rubripes (torafugu): 101074206Help
Entry
101074206         CDS       T02386                                 

Gene name
cacna2d2
Definition
(RefSeq) calcium channel, voltage-dependent, alpha 2/delta subunit 2
  KO
K04859  
voltage-dependent calcium channel alpha-2/delta-2
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101074206 (cacna2d2)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    101074206 (cacna2d2)
   04261 Adrenergic signaling in cardiomyocytes
    101074206 (cacna2d2)
Ion channels [BR:tru04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   101074206 (cacna2d2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 1106 aa AA seqDB search
MAICAQPCGLFCLLAVQTVLLILVSSPIDGTHLFPQHYTMMHWAGRIEKELDKVLQHVTG
TQQMRSIYNEKKSQFEIKRNNPKDLVERVARDISKLLNNKRKALEKLTKEAELLQKEHVW
QDSVTENSISYYDSKADSDYAEDGEEENPLESAPSLELEFVDDPNFKNKVNYSSSAVQIP
TDIYKGSPVILNELNWTQALERVFIENRREDSSLRWQVFGSATGVTRYYPATPWRAPNKI
DLYDVRRRPWYIQGASSPKDMVIIVDVSGSVSGLTLKLMKTSVMEMLDTLSDDDYVNVAR
FNEKADAVVPCFRTLVQANVRNKKIFKEAVMHMQAKGTTDYKSGFTFAFEQLLNETSAPR
ANCNKMIMMFTDGGEDRAQDIFEKYNWPNKTVRVFTFSVGQHNYDVTPLQWIACYNKGYY
FEIPSIGAIRINTQEYLDVLGRPMVLAGSRAKQVQWTNVYQDALGLGLVISGTMPVFNLT
ADAGSSQNQLILGVMGVDVAINEIKKKTPTYRLGANGYTFAIDPNGYVLLHPNLRPKIIN
FREPVTLDFLDAELEDNNKEEIRRQMIDGKSGQRKIKTLIKSVDERYIDEAMRTYTWTPV
EGTDYSLGLVLPTYSENHIKANLSDQILQVQYFEALLPNSFESEGHVFIAPREYCNDLEL
SNNNTEFLLNFIALMEKVTPDSKQCDSLLLHNLILDTGIIQQLVDKVWKNKDLNTYGFLA
VFAATDGGITRVFPNKAAETWEEDPEPFNASFYRRSLDNKGYIFRAPYRSARDDFLSPEN
DTIGILVSTAVEIAVGGKTIKPAVVGVKLDLEAWTDKFKILASNHTDRHTSNTCGPNRGC
EMDCEANSDELLCYLIDDGGFLIMSNQKDDWNKVGMFFSDVEPYLMFALYNNSFYNMKQS
YDYQSVCERLPNSEAGSAPRGVFVPTIADFVNLAWWTSAAAWSLFQQFIYGLAYQSWFIR
DEARAEGFDSKERSCVMIQTQYYLSNLSSSYNILQDCGNCSRLIHAKRINNTNLLFVVAE
KMPCSVCEIERLSQEEEEYKEDNPCEEMAVPRYRKGPSTCFDNNLSENTSDCGRGHSFRP
SLRALLLLQLLLLYPALSPLLHSILK
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atggcgatctgcgcgcagccgtgcgggcttttctgcctcctcgcagtccaaactgtactt
ctcatactggtctcttcgccgatcgacgggacccacctcttcccacagcactacacgatg
atgcactgggccggccgcattgagaaggagctggataaggttctgcagcacgtcaccggc
actcagcagatgagatcgatttataacgaaaagaagagtcagttcgagatcaagaggaac
aaccccaaggacctggtggagcgggtcgcccgggacatctccaagctgctcaacaacaag
cggaaggctctggagaaactgacgaaggaggcggagctgctgcagaaggagcacgtttgg
caggacagcgtgacggagaattccatttcatactacgattccaaagcggattcagactat
gcagaggacggggaagaagagaacccgctggagagcgcgccgtctttggagctggagttc
gtggacgatcccaacttcaaaaacaaggtcaactactcctccagcgccgtccagattccc
acagacatctacaaaggctctcccgtcattttaaacgagctgaactggacccaggctctg
gagagggtcttcatcgagaaccggcgggaggacagctctctgcgctggcaggtgttcggc
agcgccaccggagtgacgcggtattacccggccactccgtggagggcgcccaacaagatc
gacctgtacgacgtccggaggagaccatggtatatacaaggcgcgtcgtctccgaaggac
atggtcatcattgtggacgtgagcggaagcgtcagcgggctcacgctgaagctgatgaag
acctccgtcatggagatgctggacacgctgtcggacgacgactacgtgaacgtggccagg
ttcaacgaaaaggcagacgcggtcgttccctgtttcaggactttggtccaagccaacgtc
cgcaacaagaagatcttcaaggaggccgtcatgcacatgcaggccaaggggaccacggac
tacaagtccggcttcacgtttgccttcgagcagcttctgaacgagaccagcgccccgagg
gccaactgcaataagatgataatgatgtttacggatggcggtgaggatcgcgcgcaggac
atcttcgaaaagtacaactggcccaacaagacggtccgtgttttcaccttctccgtcggc
cagcacaactacgacgtcacgccgctgcagtggatcgcctgttacaataaaggttattac
tttgaaatcccatcaataggagccatccgaatcaacacgcaggagtacctggacgtcctg
ggtcgtcccatggtgctggccgggtccagagccaagcaggtgcagtggaccaacgtctac
caggacgcgctgggtttgggtctcgtcatcagtgggacgatgccagtcttcaacctcacc
gctgatgccggaagctctcagaaccagctcatcctgggagtcatgggagtcgacgtcgcg
atcaatgaaatcaagaagaagacgccaacctacagactcggggccaacggctacaccttc
gccatcgaccccaacggttacgtgctgctgcatcccaacctgcggcccaaaatcatcaac
ttccgggagcccgtcactctggatttcctggacgcagaactggaggacaacaacaaggag
gagatccgtcgacagatgattgatggcaaatcagggcagaggaaaatcaagacgctcatt
aagtcggttgatgagaggtacatcgacgaggccatgcggacctacacgtggacgccggtg
gaggggacagattacagtctaggcttggttctgccaacttatagcgagaaccacatcaag
gccaatctgagcgaccagatcctccaggtgcagtattttgaggcactgctgccaaacagt
tttgagtctgaaggacatgtgttcattgctcccagggagtactgcaacgatctggaactg
tccaacaacaacaccgagttcctgctcaactttattgccctcatggagaaggtgacgccg
gactccaaacaatgtgacagtctgctcctgcacaacctgatcctggacactggcatcatc
cagcagctcgtggataaagtgtggaagaataaagacctgaacacatatggattcctggcc
gtgttcgccgccacagatggaggaataacgagggtgttcccgaacaaggctgcagaaacc
tgggaggaggacccggagccgttcaacgccagcttttaccgccgcagtctcgacaacaag
ggctacatattccgagcgccgtaccggtcagccagagacgatttcctgagcccggagaac
gacaccatagggatcctggtcagcacggcggtggagatcgctgtcgggggaaagaccatc
aaacccgcagtggtcggggtgaagctggacctcgaggcttggacggataagttcaagatt
cttgctagcaaccacactgaccgccacacgtccaacacgtgcggtcccaaccgaggctgc
gagatggactgtgaagccaacagcgatgaactgctctgctacctaatcgacgacggcgga
ttcctgatcatgtccaatcagaaggacgactggaacaaggtggggatgttcttcagcgac
gtggagccctacctgatgttcgccctctacaacaactccttctacaacatgaaacagtcg
tacgactaccagtccgtgtgcgagcggctgcccaacagcgaggcaggatcggcgcccagg
ggagtgtttgtgcccacgattgcagacttcgtgaacctggcatggtggacttcagcggcc
gcctggtctttgttccagcagtttatatatggactcgcttatcaaagctggttcatcaga
gatgaggcgcgtgcagaagggttcgactccaaagagaggagctgtgtaatgatccagacc
cagtactacttgagcaacctcagcagctcctacaacatactgcaggactgcggcaactgc
tccaggttgattcacgccaagaggataaacaacaccaacttgctgtttgtggtagcggag
aagatgccgtgcagcgtctgcgagatagagcggctctcccaggaggaggaggagtacaag
gaagacaacccgtgtgaagagatggcggtgccgcgctaccgcaaaggcccctccacctgc
ttcgacaataacctctcggagaacacgtcagactgcggacgaggtcactccttccgcccg
tctctgcgcgctttactgctgctccagctgctcctcctgtatccggccctcagccccctc
cttcactccatactcaaataa

DBGET integrated database retrieval system