KEGG   Takifugu rubripes (torafugu): 101074310Help
Entry
101074310         CDS       T02386                                 

Definition
ectonucleoside triphosphate diphosphohydrolase 2-like
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    101074310
Enzymes [BR:tru01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     101074310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 509 aa AA seqDB search
MAHCFTRAVPIVLLVFGLAAILLLTVPTEDIQEAPGFRYGIVLDAGSSHTSLFIYKWRAD
KENGTGVVTQHSECHVKGGGISSYAGQRGAAGRSLGGCLDQAVKDIPKEKHNLTPVYLGA
TAGMRLLQLSSPQQSFQILQEVSQKIQSYPFDYRGASVLSGQEEGAYGWVTVNYLSENFI
KYGFVGHWLSPSRPTVGALDFGGASTQITFETRDKIEDDTDMIKLRLYGYEYSVYTHSFL
CYGQGQVLKRLLAHLLKSQGYSASIIHPCYPVGHSTNIKLDSIFDSPCSDKYKAQTYNSQ
STLSVRGSGHYEHCLGNVSEIFSFDNCSFSQCSFDNVFQPNVTGSFVAFSAFFYLHSFLE
RITGIRVITPSLLDQAAKTVCQMTYSQMLIRAPEDQARLQDYCAVSVFVKILMLRGYSFD
ETTFPHISFQKKVGDASVGWALGYMLTLSNLLPAEMPATRKSLSVEVWGALLFLLVFLLV
AVLLFTLLKVCFIKKSVDYHEPNTVSETL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggctcattgcttcacgcgtgctgtcccaatcgtgctgctggtgtttggactggctgcg
attctgctcctgactgtccccactgaagacatccaggaggctccggggttcaggtatggc
atcgttctggatgctggatcgtcacacacttctctgttcatatacaaatggcgagctgac
aaggaaaatgggacaggcgttgtgactcagcacagtgaatgtcatgttaaaggaggagga
atctcaagctacgcaggtcagcgcggggcagcggggcgatctttggggggctgtcttgat
caggcagtaaaggacatccccaaagagaaacacaacctcacgccagtttacctgggggca
acagccggcatgaggcttttgcagctctccagcccacaacagtcatttcagattctgcaa
gaagtgagccagaaaatccagtcgtatcctttcgactaccggggggcatcagtcctcagc
ggtcaagaggagggggcgtacggctgggtcaccgttaactatctctcagagaacttcata
aagtatggttttgtgggacactggttgagccccagcaggcccacagtgggagcgctagat
tttggcggcgcgtccacccagatcacatttgagacgcgggataagattgaggatgacact
gatatgataaagttgcgtctctatggttacgagtactctgtgtacacacacagcttcctg
tgctatggacagggccaagttcttaagaggctcctggcccatttactaaagtctcagggt
tactctgcctccatcattcatccctgctatccggtgggccacagcaccaacataaagctg
gactctatattcgattctccgtgctcagacaaatacaaagcgcagacctacaactcccag
tccactctgtcagtacgcggcagcggacattatgagcactgcctgggcaacgtgtccgag
atcttttcctttgacaactgcagtttctcccagtgctcctttgataacgtctttcagccg
aatgtcaccgggagctttgtggctttctctgcattcttctaccttcactcattcctggag
cggatcactgggatcagagttattactccttcactattggatcaggctgccaaaacagtg
tgccagatgacttacagccaaatgctgattcgtgctccagaggaccaggctcgtttgcag
gactactgtgccgtgtctgtgtttgtgaaaatactcatgttgagaggttacagctttgac
gaaacaacattcccacacatttctttccagaagaaggtcggcgacgcctcggtgggctgg
gctctcgggtacatgctcactttgagcaatttgctgccagcagagatgccggcaacaagg
aaaagtttaagcgtggaggtgtggggagcacttctgtttcttctggtattcctgctggta
gcagttctgttattcaccttattaaaggtttgttttataaagaaatcagtggactaccat
gagcccaacactgtttctgagaccttgtga

DBGET integrated database retrieval system