KEGG   Takifugu rubripes (torafugu): 101074408Help
Entry
101074408         CDS       T02386                                 

Definition
RAS guanyl-releasing protein 2-like
Orthology
K12361  
RAS guanyl-releasing protein 2
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101074408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 597 aa AA seqDB search
MESVSLEQSATVDELLEACIQAFDESGTLKDASHVRMFLMMHPWYIPSTDLAEKLVLKSQ
EKSCTAECRTKICHLVKYWISEFQAEFNLNPELADQIQHFKDFLTTEGNERQSQLIDLDS
VPSYKWKRQVTQRVPSVSKKRKMSLLFDHLDSCELAEHLTILEYKSFCKILFQDYHSFVM
HGCTVDNPILERFITLFNSVSQWIQLMVLSKPTAPQRAVVVSHFIRVAQKLLQLQNFNTL
MAVVGGLSNSSISRLKDTQAHVSSETNKVFNNLIELVTSCGNYSQYRKRFSECSGFRFPI
LGVHLKDLIAVHVALPDWVDKEKTRVNLTKTQQLYTILQELTLIQNTPPNTDANMDLLNL
LTVSLDQYHTEEEIYQMSLQREPRKPANSCPAPAPDPKPTMIDEWAVSVKPSTDPTIIKK
HIEKMVESVFKNFDTDGDGHISRDEFEAIRNNFPYLSKFGELDKNQDGKISREEMIDYFM
KASSLLNCKMGFIHTFTETTYVKPTFCEHCAGFIWGFYKQGYKCKACGVNCHKACRGRLA
VECRKRTKSISHEAPPTLQARSFSFPPPANTSPSLQNTVIAEEDIETVEEGVFDVHL
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgtgtcgctggagcagtcggcaacagtggatgagctgctggaagcgtgcatc
caagccttcgatgagtcgggaacattaaaggatgcttcccatgtccgcatgttcctcatg
atgcacccttggtacatcccatccaccgacttggctgagaagctggtgctaaaatctcaa
gagaagagctgcactgccgagtgccgaacaaaaatatgccatctcgtgaagtactggatc
tccgagtttcaagccgagttcaacctgaacccggagctggctgaccagatccaacacttt
aaagacttcttgaccacggagggcaacgagaggcagagccagctcattgacctggacagt
gtaccgtcgtataaatggaagcggcaggtgacccagcgtgtcccatcggtgtccaaaaag
aggaaaatgtcactgctgttcgaccaccttgattcctgtgaactggcggagcacctcact
atcctggagtacaaatccttttgcaagatcttgtttcaggactaccacagctttgtgatg
catggctgcacggtggacaaccccatcctggagcgtttcatcactctcttcaacagcgtc
tcccagtggatccagctcatggtgctcagcaagcccaccgccccgcagagagctgtcgtc
gtctcccatttcatcagggtggcgcagaagctgctgcagttacaaaacttcaacacgctg
atggcggtggtgggcggcctcagcaacagctccatctcacggcttaaagacacacaggcg
cacgtcagctctgagaccaacaaggttttcaacaacctcattgaactggtgacatcctgt
gggaactacagccagtaccgcaagcggttctccgagtgctcgggatttcgattccccatc
ctgggcgtgcacttgaaagacctcatagctgtgcacgtggcattaccagactgggtcgac
aaagagaaaacgcgggtcaacctgaccaaaacccagcagctttacaccatcctccaagag
ctaacactcatccagaacaccccgcccaacactgacgctaacatggatttgctcaacctg
ctcacggtgtctttggaccaataccacacagaggaggagatctaccaaatgtctctacag
agggaacctcgcaagccggcaaactcctgccctgcccctgcgcctgaccccaagccgacc
atgatcgatgaatgggcggtgtcggtgaagcccagcactgaccctacaatcatcaaaaaa
cacatcgagaagatggtggagtccgttttcaagaactttgacacggatggcgacggccac
atttccagggacgagtttgaagccatcaggaacaacttcccttacctcagcaagtttggc
gagctggacaagaaccaagacgggaagatcagcagggaagagatgattgactacttcatg
aaagccagctcactgcttaactgcaagatgggcttcatccacacatttactgagaccacg
tacgtgaagccaacattctgcgagcactgcgctggctttatatggggcttctacaagcag
ggatacaagtgcaaagcctgcggggtcaattgtcacaaggcctgcagaggacgcctggcc
gttgagtgcaggaagaggaccaagagcatcagccacgaggcgccaccgacactccaggcc
aggtctttcagcttccctccgcctgctaacacctcgcccagcctgcagaacacagtaata
gcagaggaggatatagaaacagtggaggaaggagtttttgatgtccacttataa

DBGET integrated database retrieval system