KEGG   Takifugu rubripes (torafugu): 101074431Help
Entry
101074431         CDS       T02386                                 

Definition
cGMP-dependent protein kinase 2-like
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Gap junction
Module
cGMP signaling
Brite
KEGG Orthology (KO) [BR:tru00001]
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    101074431
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     101074431
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   101074431
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
21
AA seq 775 aa AA seqDB search
MGNASMKSKRYKNADGSVTASNSWSHRDGRRLKNASLESLRVRVEELEREGKRRNEELQA
KEQQIRSLQEQLARQTRVLAELSEELQTKCIQLSKLQDVMKSQGGAGTASRPTSVRKAGK
SSPNLSVRIKETLNRRKGAKAGVSAEPTSSSLPKFCFEKARVAKDVSVKKLLTDALNKNQ
YLRRLELQQIKDIVECMYERTYQRGEYVVKQGEPGNHLFVLADGTLDVFQHNKLLTSITV
WTTFGELAILYNCTRTASVRAVNDVRTWALDREVFQNIMRRTAEMRHEQYRNFLRSVSLL
ANLPEDKLSKMVDCLEVEYYDKGEFIIREGEEGSTFYIIAQGKVKVTQTTEAHTFPQVIN
TLQKGDYFGEKALVSDDVRSASILAEENGVECLVIDRETFDQTVGTFSELQKHLQGYVAT
LDRDDRKRHARKKSVSRHQSQPLSSDAICLKEMVSTFSASRPFDHLEVVATLGVGGFGRV
ELVKMQDKDVAFALKIIKKKHVVDNRQEEHIHSERKILAEARSPFIVKLYRTFKDNKYVY
MLLEACLGGEVWSLLRDRGNFEEPTAKFCVGCVTEAFDYLHRKGILYRDLKPENLLLDAE
GYIKLVDFGFAKKIRCGQKTWTFCGTPEYVAPEIILNKGHNFSVDFWSLGILVFELLTGS
PPFSGSDQMMTYTFILKGIEKMDFPKKITKRPEDLIRKLCRQNPAERLGNLKNGITDIKK
HRWFNGFSWEGLKAKTLPSPLKRALTGPTDHSYFDSYPPDEDSPPDELSGWDVDF
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atggggaacgcttccatgaaatcgaagcgttacaagaacgcggacggttctgtcactgcg
tccaacagctggagccacagggacggccgcaggctcaagaacgcatccctggagtccctg
agggtgcgagtggaggagctggagcgagagggcaagaggaggaacgaggagctccaggcc
aaagagcagcagatcaggagcctccaggagcagctggcccggcagacccgggtcctggct
gagctgagcgaagagctgcagaccaagtgcatccagctcagcaagctgcaggatgtgatg
aagagccaggggggcgccggcacggcgtccaggcccacctccgtcaggaaggccgggaag
agcagccccaacctcagcgtccgcatcaaggagaccctcaacaggaggaagggggccaaa
gccggagtgtcggccgaacccacgtccagcagcctgcccaagttctgcttcgagaaagcc
cgggtggcgaaggatgtgagtgtgaaaaagctgctgacggacgccctgaacaagaaccag
tacttgaggaggctggagctgcagcagatcaaagacatcgtggagtgcatgtacgagcgc
acgtaccagcggggggagtacgtggtcaagcagggagaacctgggaaccatctgttcgtg
ctggcagacgggacgctggatgtgttccagcataacaaactgctcacgtcgatcacggtg
tggaccacgttcggagagctagccattctgtacaactgcacgcggaccgcgtcagtgcga
gcggtcaatgatgtgaggacatgggcgctggaccgagaggtgtttcagaacatcatgagg
aggacggccgagatgcgtcatgaacaatatcgcaacttcctcagaagcgtttcactcttg
gcaaacttaccagaggacaagctgagcaagatggtggactgcttggaagtggaatactat
gataaaggagagttcatcatccgggagggagaggagggcagcaccttctacatcatcgct
cagggaaaggtgaaggtgacccagaccacagaggcccacacgttcccacaggtcataaac
acgttgcagaagggagactactttggagagaaggccctcgtcagcgatgacgtcagatcg
gccagcatcctcgctgaggagaacggtgtggagtgtctggtcatcgaccgagagacattc
gatcagacggtgggcacgttcagcgagctgcagaagcacctccagggctacgtggcgacg
cttgatcgggatgacaggaagagacatgccaggaaaaagtccgtgtcacggcaccagagt
cagccgttgtcatcggacgcgatctgcctgaaggagatggtgtcaacgttctccgcgtcc
aggcccttcgaccacctggaggtcgtcgcgacgctcggggtgggcggatttgggcgggtg
gagctggtgaagatgcaggacaaggacgttgccttcgcgctgaagatcataaagaagaag
cacgtggtggacaaccggcaggaggagcacatccactcggagagaaagatcctcgccgag
gctcgctcaccgttcattgtgaaactatatcgcacatttaaagacaacaaatacgtctac
atgctgctggaagcctgtctgggaggagaggtgtggagtctgctcagagacagggggaat
tttgaagaacccactgccaaattctgcgtcggctgcgtcaccgaggcctttgattacctc
caccgtaaaggcatcctctacagggacctgaagcccgagaatctattgctggatgctgaa
ggctacatcaaactggtcgactttggttttgccaaaaagatcagatgtggccagaagacc
tggacgttctgtgggaccccggaatacgtggcccccgagatcatcctcaacaagggccac
aacttcagtgtggacttctggtctctgggtattctggtgtttgagcttctcaccggcagt
cctccattttcagggagtgaccagatgatgacgtacaccttcatcctgaaaggcatcgag
aagatggacttccccaagaagatcaccaagagacccgaggacctgatacgcaagttatgc
aggcaaaaccctgctgagcgactgggcaacctgaaaaatggaataactgatatcaagaaa
cacaggtggttcaatggtttcagctgggagggactcaaggcgaagactttaccgtctcct
ctgaaacgagcacttacaggaccgacggatcacagttactttgacagctaccctccagat
gaagacagtcctcccgacgagctgtctggttgggacgtggacttctga

DBGET integrated database retrieval system