KEGG   Takifugu rubripes (torafugu): 101074451Help
Entry
101074451         CDS       T02386                                 

Definition
cyclic AMP-responsive element-binding protein 1-like
Orthology
K05870  
cyclic AMP-responsive element-binding protein 1
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Adrenergic signaling in cardiomyocytes
Melanogenesis
Brite
KEGG Orthology (KO) [BR:tru00001]
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    101074451
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101074451
Transcription factors [BR:tru03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   CREB
    101074451
Mitochondrial biogenesis [BR:tru03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    101074451
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 316 aa AA seqDB search
MEAGADTQQSGETAVAESEAQHITLAQASIAAAQVSSSSPTVTLVQLPNGQTVQVHGVIQ
AAQPSVIQSPQVQTVQISTVAESEDSQESVDSVTDSQKRREILSRRPSYRQILNDLSSDA
PAVPRIEEEKSEDDSAPAITTVTMPTPIYQTSSGQYIAITQGGAIQLANNGTDGVQGLQT
LTMANTTAGQPGTTILQYAQTSDGQQILVPSNQVVVQAASGDVQAYQIRTAATSAITPGV
VMATSPALGAGGVTEEVTRKREVRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTL
IEELKALKDLYCHKSE
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggaggctggtgcagacacacagcaaagtggtgaaacagctgtcgcagagtcagaggcc
cagcacatcaccctggcccaggcgtctatagcagcggcccaggtttcctccagtagtccc
acagtaacactggtgcagcttcccaacggccagacggtccaagtgcacggtgtgatccaa
gccgcccagccctctgtcattcagtctccacaagttcagactgtgcagatatcgaccgtt
gccgagagcgaggactcccaggagtctgtggacagtgtgacagactctcagaagaggaga
gagatcctctctcggaggccgtcctacaggcaaatcctcaacgatttatcgtcagacgct
cccgcggtgcctcgaatcgaagaagagaagtccgaggacgactctgcccccgccatcact
acggttaccatgcccactcccatctatcagaccagcagcggccagtacatcgccatcact
caaggtggggcgatccagctggccaacaacggcacagacggcgtgcagggtctgcagacg
ctgaccatggcaaacaccacggccggccagcccggcacaaccatcctgcagtacgcccag
accagtgacgggcagcagattctcgtccccagcaaccaggtggtcgtacaagcggcctca
ggcgacgtccaggcctatcaaatccgcacagccgccaccagcgccatcactccgggggtg
gtcatggccacttcgccggcactgggtgcaggtggggtcaccgaagaggtcacacgcaaa
agggaagtccggcttatgaaaaacagggaggcagctcgcgagtgtcgcaggaagaagaag
gaatacgtcaagtgtctggagaaccgcgtcgcagtgctggagaaccagaacaagaccctc
atcgaggaactcaaagccctcaaagacttgtactgccacaaatctgagtag

DBGET integrated database retrieval system