KEGG   Takifugu rubripes (torafugu): 101074470Help
Entry
101074470         CDS       T02386                                 

Definition
serine/threonine-protein kinase mTOR-like
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
tru  Takifugu rubripes (torafugu)
Pathway
ErbB signaling pathway
mTOR signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    101074470
   04150 mTOR signaling pathway
    101074470
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101074470
   04920 Adipocytokine signaling pathway
    101074470
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [Table]
   101074470
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 2551 aa AA seqDB search
MSGTATVLQQFVSGLKSRNEDNRAKSAKDLQHYVTTELRELSQDEATTFYDELNHHIFEL
VSSSDVNEKKGGILAIVSLIGVEGGNATRISRFANYLRNLLPSSDPVVMEMGSKAMGHLS
MAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAVSAPTFFFQQVQPFFDNI
FYAVWDPKQAIREGAVSALRACLILTTQRETKEMQKPQWYKQTFEEAEKGFDETLAKEKG
MNRDDRVHGALLILNELVRISSMEGERMREEMEEITQQQLVHDRYCKEMMGFGTKPRHIT
PFTSFQSLQPQQSNALLGLLGYSTPQGFLTFGAAPAPAKTSLVESRYCRELMEERFDQVC
RWVLKYRTSKNPLIQMTILNLLPRLAAFQPHIFTDQYLSDTMGYLLGCLKKEKERTAAFQ
ALGLLVVAVRAEIQPYLLKVLEIIKAALPPKDFAHKRQKTMQVDATVFTCISMLSRAMGP
SIQPDIKELLEPMLAVGLSPALTAVLHDLSRQIPQLKKDIQDGLLKMLSLVLMHKPLRHP
GMPKGLAHQLASPSLTNIPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLNSEH
KEIRMEAARTCSRLLTPSIHLISGHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYCVLA
SLDERFDAHLAQAENLQALFVALNDEVFEIRELAICTIGRLSSMNPAYVMPFLRKMLIQI
LTELEHSGVGRNKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPNPGVVISVL
ATIGELAQVSGLEMRKWMDELFPIIMDMLQDSSSLAKRQVALWTLGQQVASTGYVVEPYR
KYPSLLEVLLNFLKTEQNQGIRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASAVSLSE
SKSSQDSADYSTSEMLVNMGNLPLDEFYPAVAIVTLMRILRDPSLSNHHTMVVQAVTFIF
KSLGLKCVQFLPQVMPTFLNVIRVCDASIREFLFQQMGMVVCFVKIHIRPYMDDIFTLIR
EYWTPNNPMQNTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSTGRSVTMKLLNA
IQLFGANLDDYLHLLLPPIVKLFDAPDVPLQARKVALETLERLTESLDFTDYASRIIHPI
VRTLDSTPELRSTSMDTLSSLVFQLGKKYQIFIPMVNKVMLKHRINHQRYDMLICRIVKG
YTLAEEEEDTILQHRQSRGKPGDALVSGPVEAGPMKKLHVSTTALQKAWGAARKVSKDDW
LEWLRRLSVVLLKESSSPALRSCWSLAQTYIPLARDLFNAAFLSCWSELSEDQQDELIRS
IELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKALHYK
ELEFQKGPSPLILESLISINNKLQQPEAASGVLDYAMKHFSELEIQATWYEKLHEWEDAL
VAYDKKIDMNKEDPELILGRMRCLEALGEWGQLHQQCCEEWALVSEETQAKMARMAAAAA
WGLGHWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAG
ESYSRAYGAMVSCQMLSELEEVIQYKLVPERRDIIRETWWERLQGCQRIVEDWQKILMVR
SLVISPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSKQLDHPLPTAHPHVTYAY
MKYMWKSSRKIDAFQHMQHFVQGMQQQAQHAIAAEDQQHKLELHKLMARCFLKLGEWQLS
LQGINESTIPKVLQYYSHSTEHDRNWYKAWHAWAVMNFEAVLHYKHQNQGRDEKKKLRHG
SGASANSEASNSDSEADSTDHSPSPGQKKVNEDLSKTLLLYTVPAVQGFFRSISLSRGNN
LQDTLRVLTLWFDYGHWPEVNEALVEGIKTIQIDTWLQVIPQLIARIDTPRALVGRLIHQ
LLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHCNTLVQQAIMVSEELIRV
AILWHEMWHEGLEEASRLYFGERNVKGMFAVLEPLHAMMERGPQTLKETSFNQAYGRDLM
EAQDWCRKYMRSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELA
VPGTYDPNQPIIRIQSIAASLQVITSKQRPRKLTIMGSNGHEFMFLLKGHEDLRQDERVM
QLFGLVNTLLANDPASLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKI
LLNIEHRIMLRMAPDYDHLTLMEKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTN
YTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRL
TRMLTNAMEVTGLDGNYRITCHTVMEVLREHRDSVMAVLEAFVYDPLLNWRLMDTNTKGN
KRSRTRNDSYTAGQSVEALEGIDLGETTHKKPGNTVPESIHSFIGDGLVQPEALNKKAIQ
IINRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLCQCYIGWVSEASGHSWKMNGA
APLYFVMVSKKALNGIERLSASHKWDLCSLV
NT seq 7656 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggcacagccactgtgctgcagcagtttgtcagtggattgaagagccggaatgaa
gacaacagagcaaaatccgctaaggatctgcagcactatgtgaccacagagctcagagag
ttaagccaagatgaagccacaacattctacgatgagttaaaccaccacatatttgagctg
gtatccagctctgatgtgaatgaaaagaaaggagggattctcgccattgtgagtttgatc
ggagtcgagggaggcaatgctaccaggattagccgctttgccaactacctgcgcaacctt
ctcccatccagcgaccctgtggttatggagatggggtctaaagccatgggccacctctcg
atggcaggggacaccttcactgctgagtatgtggagtttgaagtgaaaagggccctggag
tggctgggcgcagacagaaatgaaggcagacgccatgctgcagtgctggtgttgagggag
ttggctgtgagtgccccaactttcttctttcagcaagttcagccgttctttgacaacatc
ttttacgcagtatgggaccctaagcaggccatccgagaaggggctgtgtctgcactgcga
gcctgtctcatccttaccactcagagagagaccaaagaaatgcaaaagccacagtggtac
aagcaaacgtttgaggaggccgagaaaggcttcgacgagactctggccaaggaaaaagga
atgaatcgtgatgatcgggtccacggtgctctcctcatcctgaacgagctggttcgcatc
agcagcatggaaggagagcgcatgcgtgaggaaatggaggaaatcacacagcagcaactg
gtccatgatagatactgcaaggagatgatgggatttgggaccaagcctcgccacatcaca
cctttcacaagctttcagtcgttgcagccacagcagtctaacgccctcctgggcctgctg
ggctacagcactcctcaaggcttcctcaccttcggggctgcaccggcgcctgccaagacc
tctctggtagaaagtcgatactgtcgtgagctgatggaagagcggtttgaccaggtgtgt
cggtgggtgctgaaataccggaccagtaaaaaccctctgatccagatgaccattctcaac
ctgcttccacgtttggctgccttccagcctcatatctttacagaccagtatctgtcagac
actatgggctacctgctgggctgtttgaagaaggagaaggagcggacagcagcgttccag
gccctggggctgttggtggtggctgtgagagcagaaatccagccatatcttttaaaggtt
cttgagatcatcaaggctgccctgccgcccaaagactttgctcacaagcgacagaagacc
atgcaggtggacgccaccgtctttacttgtatcagcatgctttccagagccatgggtcct
agcatccaaccagacatcaaggaactcctggaacccatgctggctgttggcctcagtcct
gcactgacggcagtcctgcacgacctgagccgtcaaatcccccagttgaagaaggacatc
caggacggtctactcaagatgctttccttagttttgatgcataagcccttgcgtcatccc
gggatgcccaaaggcctggctcaccaactggcctccccgagcctcacaaacatcccagag
gccagcgatgtgggcagcatcacgctggccctgcgaacactgggcagctttgaatttgaa
ggacattccctcacccagtttgtgcgccactgtgctgatcacttcttgaacagcgagcat
aaggaaataaggatggaggcagctcgaacctgctcgcgcctgctcactccttccattcac
ctgatcagcggccatgttgtcagtcagactgctgtgcaggttgtcgcagatgtgctcagc
aagctgctcgtggttggcatcactgacccagatccagacatccggtactgtgtgctggcc
tcacttgatgagcgttttgatgctcacctggcccaggccgagaacctacaggcactattt
gtcgcactgaatgatgaggttttcgagatcagagagttggccatctgcacaatcggacga
ctcagcagcatgaaccctgcctatgttatgcccttcctgcgaaagatgctcattcagatc
ttaacggagctggagcacagcggtgtcggcaggaacaaggagcagagcgctcgtatgctt
ggtcacctggtctccaacgcccctcgtctcatacggccatatatggagcccatcctcaag
gctctaatcctcaaactgaaagacccagacccgaatcctggagtggtcataagcgtcttg
gcaactattggagagttggctcaggtgagcggcttggaaatgagaaagtggatggatgag
ctttttccaatcatcatggacatgctgcaagactcgtcatcactggccaaacgacaagtg
gcgctgtggacgttgggccagcaagtggccagcacaggttatgtggtggagccttaccgc
aagtacccctcccttctggaggtgctgctcaacttcctgaagacagaacagaaccagggc
atcaggagagaggctatacgtgttctgggtctcctgggcgcgctggacccctacaagcac
aaggtgaacatcgggatgatcgaccagtcacgggacgcctctgccgtcagtctctctgag
tcgaagtccagccaggactcagcggactacagcacgagtgagatgctagtgaacatgggc
aaccttcccctggatgagttttatccagctgtggccattgtcactttaatgcgcatcctg
agagacccctccctgtccaaccatcacacaatggtggtccaggctgtgacctttatcttt
aagtctctgggtctgaagtgtgtccagtttctgccccaggtcatgcccacgttcctaaat
gtaattcgggtgtgtgatgccagtatccgagagttccttttccagcagatgggaatggtg
gtgtgctttgttaagatccacatccggccctacatggacgacatcttcacgctcatcaga
gagtactggacaccgaacaaccccatgcagaataccatcatccttctgatcgagcagatt
gtggtggcactgggaggagaattcaagctttacctgcctcagcttatcccacacatgctg
cgcgtcttcatgcatgacaatagtactggtcgtagtgttaccatgaagttacttaatgcc
atccagctgtttggtgccaacttagatgactacctgcacttgctacttcctccgattgtc
aaactgtttgatgctcctgatgtgcccctgcaagcccgcaaggttgccctggagacactg
gagcgcctcacagagtccctggacttcacggactatgcgtcacgcattatccaccccata
gttaggacacttgacagtacgccggaattgcgctccacctctatggacaccctgtcctca
ctagtgttccagttgggaaagaagtaccagatcttcatccccatggtgaataaagtgatg
ctgaagcacaggattaaccatcagcgttatgacatgctcatatgtcgcatcgttaaggga
tatactctggctgaggaggaagaggacacaatcctccaacatcgccagtctcgtggtaaa
ccaggcgacgcattggtcagcggaccggtggaggcagggcccatgaaaaagcttcatgtc
agcactaccgcacttcaaaaggcttggggcgctgccaggaaggtgtccaaagacgactgg
ttggagtggctgcggcgcttaagtgtcgtcctgctcaaagagtcatcatccccagctctc
cgatcgtgctggtccctggctcagacctacatccctcttgccagggacttgttcaacgcc
gccttcctctcttgttggtcggagctgagcgaggatcaacaggacgaactcatccgcagc
atcgagttagcgctcacctctcaggatatcgcagaggtcacacagactctgctcaacctg
gcggagtttatggaacacagcgacaagggtcctctacccctccgcgatgataatggcatc
gtgctgcttggtgagagagcggccaagtgtcgagcttacgctaaagctttgcattacaaa
gagctggagtttcaaaagggtccttcgccacttattctggagtctcttatcagcatcaac
aataaactgcagcagccagaagcagcgtcgggggtgctggactatgcaatgaagcatttt
agtgaactggaaattcaagccacctggtacgagaagctacacgagtgggaggatgccctg
gtagcttatgacaagaagatcgacatgaacaaagaggaccctgagctcatcctgggcagg
atgcgctgcttagaggccctgggagaatggggccagttacaccagcagtgctgtgaggaa
tgggcactggtgagcgaggaaacccaggccaagatggcgcgcatggctgctgccgccgca
tggggtctaggacactgggacagcatggaggagtacacatgcatgatcccgagagatacg
catgatggagcgttttacagagctgtgctggccctgcatcaggacctcttctcattggcc
cagcaatgtattgacaaagcaagggatctcctggacgctgagctgacagccatggctgga
gagagctacagtcgagcttatggggcaatggtgtcctgccagatgctgtcagagctagag
gaggtgatccagtacaagttggtcccagagaggagggacatcatcagggaaacatggtgg
gagaggcttcagggttgtcagcgtatcgtagaagactggcaaaagatcctaatggtcaga
tctcttgtcatcagcccccatgaagacatgaggacttggctgaagtacgccagcctctgt
ggcaagagtggacgcctggcgctggcccataagacccttgtgcttcttctgggtgttgac
ccctctaagcagttggatcatccactgcccacagcccacccacacgtcacctacgcttac
atgaagtacatgtggaagagttcccgcaagatcgatgccttccagcacatgcagcacttc
gtgcaaggtatgcagcagcaagcccagcacgctatcgcagctgaggatcagcagcataag
ctggagctccacaaactgatggccagatgtttcctaaaactgggcgagtggcagctcagt
ttgcagggcatcaacgagagcaccattcctaaagtcctccagtattacagccattccacg
gagcatgaccgcaactggtacaaggcctggcacgcctgggcagtgatgaattttgaggct
gtactgcactacaagcaccagaatcaaggacgggacgagaagaagaagctgcgtcacggc
agcggcgccagcgctaacagcgaagccagcaacagcgacagcgaggctgacagcaccgat
cacagtccctccccgggtcagaaaaaggtcaacgaggacctctcaaagacgttgctgcta
tacacagttcctgctgttcaaggcttcttccgctccatttccctttccagaggcaacaac
ctgcaggacaccctcagggttttgactttgtggtttgactatggccactggcctgaggtc
aatgaagccttggtggagggcatcaagactatccagatagacacgtggctacaggtgatc
cctcagctcatagctcgaattgacacaccacgagctctggtgggtcggctcatccaccag
ctgctgacagacatcgggcggtaccatccacaagctttaatctacccgctgaccgtggcg
tccaagtccacgaccaccgcccgccataatgctgctaataagatcctgaagaacatgtgc
gagcactgcaacaccctggtccagcaggccatcatggtgagcgaggagcttatccgagtg
gccatcttgtggcacgagatgtggcatgaagggctcgaagaggcgtcacgcctgtacttt
ggcgagcgcaacgtcaagggcatgtttgctgtgctagaacccctgcatgccatgatggag
aggggaccacagaccctgaaagagacctcttttaaccaagcatatggtcgcgatttgatg
gaggcgcaggactggtgcagaaaatacatgcgctctggaaatgtaaaagacttgactcag
gcctgggacctgtattatcacgtgttcagacgcatctcaaaacaactccctcagttgacc
tccttggagctacagtacgtgtctcccaagctgctgatgtgccgagacctggagctcgca
gtaccaggcacttacgaccccaatcagcccatcatccgcattcagtctatcgccgcttcg
ctgcaggtcatcacctccaagcagcgcccacgcaagctcaccatcatgggcagcaacggc
catgagttcatgttcctgttgaagggccacgaggacctgaggcaggacgagagagtcatg
cagctgttcggcctggttaacacgctgctcgccaatgaccccgcgtccttgcgcaagaac
ctcagcatccagcgttacgcagtgatccctctgtccaccaactcgggcctgattggatgg
gtgccccactgtgacacgctgcacgccctcatcagagactacagagagaagaagaagatt
ctgctcaacatcgagcatcgcatcatgctcaggatggccccagactacgaccacctgacc
ctgatggagaaggtggaggtgttcgagcacgccgtcaacaacacggccggagacgacctc
gccaagctcctgtggctcaagagccccagctccgaggtgtggtttgacagaaggaccaat
tacacccgctccctggctgtcatgtccatggtgggctacatcctgggcctgggagacagg
catccctccaacctgatgttagaccgactgagcggaaagatcctccacatcgacttcggg
gactgttttgaagtcgccatgaccagagagaagttccctgaaaagatcccgttcagactg
acgaggatgctgaccaacgccatggaggtgacaggcctggatggaaactaccgcatcacc
tgccacacagtgatggaggtgctgagggagcatcgcgacagcgtcatggccgtgctggag
gcgttcgtctacgacccgctgctcaactggaggctcatggacacaaacaccaaaggcaac
aagcgctcccgcaccagaaacgactcatacaccgccggacaatcagtggaggccctcgag
ggaatcgacctgggagagaccacgcacaagaaaccggggaacactgtacccgagtccatc
cactccttcattggagatggtttggtccaacctgaggcgctcaacaagaaagctattcag
atcatcaacagggtgagagacaaactcacgggacgagacttttcccacgatgacacgctg
gatgttcccacacaagtggagctcctcattaaacaggccacatcccacgaaaacctgtgc
cagtgctacatcggatgggtgtcagaggcttctggccacagctggaagatgaatggtgcc
gcaccactctactttgtcatggtgtccaagaaggctctaaatggcattgagaggctctca
gcctctcataaatgggatctctgcagccttgtgtaa

DBGET integrated database retrieval system