KEGG   Takifugu rubripes (torafugu): 101074470Help
Entry
101074470         CDS       T02386                                 

Gene name
mtor
Definition
(RefSeq) mechanistic target of rapamycin
  KO
K07203  
serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
ErbB signaling pathway
Autophagy - other
Autophagy - animal
mTOR signaling pathway
Cellular senescence
Apelin signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04012 ErbB signaling pathway
    101074470 (mtor)
   04371 Apelin signaling pathway
    101074470 (mtor)
   04150 mTOR signaling pathway
    101074470 (mtor)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    101074470 (mtor)
   04136 Autophagy - other eukaryotes
    101074470 (mtor)
  Cell growth and death
   04218 Cellular senescence
    101074470 (mtor)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101074470 (mtor)
   04920 Adipocytokine signaling pathway
    101074470 (mtor)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101074470 (mtor)
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   101074470 (mtor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
3
AA seq 2513 aa AA seqDB search
MVIMSGTATVLQQFVSGLKSRNEDNRAKSAKDLQHYVTTELRELSQDEATTFYDELNHHI
FELVSSSDVNEKKGGILAIVSLIGVEGGNATRISRFANYLRNLLPSSDPVVMEMGSKAMG
HLSMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAVSAPTFFFQQVQPFF
DNIFYAVWDPKQAIREGAVSALRACLILTTQRETKEMQKPQWYKQTFEEAEKGFDETLAK
EKGMNRDDRVHGALLILNELVRISSMEGERMREEMEEITQQQLVHDRYCKEMMGFGTKPR
HITPFTSFQSLQPQQSNALLGLLGYSTPQGFLTFGAAPAPAKTSLVESRYCRELMEERFD
QVCRWVLKYRTSKNPLIQMTILNLLPRLAAFQPHIFTDQYLSDTMGYLLGCLKKEKERTA
AFQALGLLVVAVRAEIQPYLLKVLEIIKAALPPKDFAHKRQKTMQVDATVFTCISMLSRA
MGPSIQPDIKELLEPMLAVGLSPALTAVLHDLSRQIPQLKKDIQDGLLKMLSLVLMHKPL
RHPGMPKGLAHQLASPSLTNIPEASDVGSITLALRTLGSFEFEGHSLTQFVRHCADHFLN
SEHKEIRMEAARTCSRLLTPSIHLISGHVVSQTAVQVVADVLSKLLVVGITDPDPDIRYC
VLASLDERFDAHLAQAENLQALFVALNDEVFEIRELAICTIGRLSSMNPAYVMPFLRKML
IQILTELEHSGVGRNKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDPDPNPGVVI
SVLATIGELAQVSGLEMRKWMDELFPIIMDMLQDSSSLAKRQVALWTLGQQVASTGYVVE
PYRKYPSLLEVLLNFLKTEQNQGIRREAIRVLGLLGALDPYKHKVNIGMIDQSRDASAVS
LSESKSSQDSADYSTSEMLVNMGNLPLDEFYPAVAIVTLMRILRDPSLSNHHTMVVQAVT
FIFKSLGLKCVQFLPQVMPTFLNVIRVCDASIREFLFQQMGMVVCFVKIHIRPYMDDIFT
LIREYWTPNNPMQNTIILLIEQIVVALGGEFKLYLPQLIPHMLRVFMHDNSTGRSVTMKL
LNAIQLFGANLDDYLHLLLPPIVKLFDAPDVPLQARKVALETLERLTESLDFTDYASRII
HPIVRTLDSTPELRSTSMDTLSSLVFQLGKKYQIFIPMVNKVMLKHRINHQRYDMLICRI
VKGYTLAEEEEDTILQHRQSRGKPGDALVSGPVEAGPMKKLHVSTTALQKAWGAARKVSK
DDWLEWLRRLSVVLLKESSSPALRSCWSLAQTYIPLARDLFNAAFLSCWSELSEDQQDEL
IRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGIVLLGERAAKCRAYAKAL
HYKELEFQKGPSPLILESLISINNKLQQPEAASGVLDYAMKHFSELEIQATWYEKLHEWE
DALVAYDKKIDMNKEDPELILGRMRCLEALGEWGQLHQQCCEEWALVSEETQAKMARMAA
AAAWGLGHWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTA
MAGESYSRAYGAMVSCQMLSELEEVIQYKLVPERRDIIRETWWERLQGCQRIVEDWQKIL
MVRSLVISPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVDPSKQLDHPLPTAHPHVT
YAYMKYMWKSSRKIDAFQHMQHFVQGMQQQAQHAIAAEDQQHKLELHKLMARCFLKLGEW
QLSLQGINESTIPKVLQYYSHSTEHDRNWYKAWHAWAVMNFEAVLHYKHQNQGRDEKKKL
RHGSGASANSEASNSDSEADSTDHSPSPGQKKVNEDLSKTLLLYTVPAVQGFFRSISLSR
GNNLQDTLRVLTLWFDYGHWPEVNEALVEGIKTIQIDTWLQVIPQLIARIDTPRALVGRL
IHQLLTDIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHCNTLVQQAIMVSEEL
IRVAILWHEMWHEGLEEASRLYFGERNVKGMFAVLEPLHAMMERGPQTLKETSFNQAYGR
DLMEAQDWCRKYMRSGNVKDLTQAWDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDL
ELAVPGTYDPNQPIIRIQSIAASLQVITSKQRPRKLTIMGSNGHEFMFLLKGHEDLRQDE
RVMQLFGLVNTLLANDPASLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREK
KKILLNIEHRIMLRMAPDYDHLTLMEKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDR
RTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIP
FRLTRMLTNAMEVTGLDGNYRITCHTVMEVLREHRDSVMAVLEAFVYDPLLNWRLMDTNT
KGNKRSRTRNDSYTAGQSVEALEGIDLGETTHKKPGNTVPESIHSFIGDGLVQPEALNKK
AIQIINRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7542 nt NT seq  +upstreamnt  +downstreamnt
atggttattatgtcaggcacagccactgtgctgcagcagtttgtcagtggattgaagagc
cggaatgaagacaacagagcaaaatccgctaaggatctgcagcactatgtgaccacagag
ctcagagagttaagccaagatgaagccacaacattctacgatgagttaaaccaccacata
tttgagctggtatccagctctgatgtgaatgaaaagaaaggagggattctcgccattgtg
agtttgatcggagtcgagggaggcaatgctaccaggattagccgctttgccaactacctg
cgcaaccttctcccatccagcgaccctgtggttatggagatggggtctaaagccatgggc
cacctctcgatggcaggggacaccttcactgctgagtatgtggagtttgaagtgaaaagg
gccctggagtggctgggcgcagacagaaatgaaggcagacgccatgctgcagtgctggtg
ttgagggagttggctgtgagtgccccaactttcttctttcagcaagttcagccgttcttt
gacaacatcttttacgcagtatgggaccctaagcaggccatccgagaaggggctgtgtct
gcactgcgagcctgtctcatccttaccactcagagagagaccaaagaaatgcaaaagcca
cagtggtacaagcaaacgtttgaggaggccgagaaaggcttcgacgagactctggccaag
gaaaaaggaatgaatcgtgatgatcgggtccacggtgctctcctcatcctgaacgagctg
gttcgcatcagcagcatggaaggagagcgcatgcgtgaggaaatggaggaaatcacacag
cagcaactggtccatgatagatactgcaaggagatgatgggatttgggaccaagcctcgc
cacatcacacctttcacaagctttcagtcgttgcagccacagcagtctaacgccctcctg
ggcctgctgggctacagcactcctcaaggcttcctcaccttcggggctgcaccggcgcct
gccaagacctctctggtagaaagtcgatactgtcgtgagctgatggaagagcggtttgac
caggtgtgtcggtgggtgctgaaataccggaccagtaaaaaccctctgatccagatgacc
attctcaacctgcttccacgtttggctgccttccagcctcatatctttacagaccagtat
ctgtcagacactatgggctacctgctgggctgtttgaagaaggagaaggagcggacagca
gcgttccaggccctggggctgttggtggtggctgtgagagcagaaatccagccatatctt
ttaaaggttcttgagatcatcaaggctgccctgccgcccaaagactttgctcacaagcga
cagaagaccatgcaggtggacgccaccgtctttacttgtatcagcatgctttccagagcc
atgggtcctagcatccaaccagacatcaaggaactcctggaacccatgctggctgttggc
ctcagtcctgcactgacggcagtcctgcacgacctgagccgtcaaatcccccagttgaag
aaggacatccaggacggtctactcaagatgctttccttagttttgatgcataagcccttg
cgtcatcccgggatgcccaaaggcctggctcaccaactggcctccccgagcctcacaaac
atcccagaggccagcgatgtgggcagcatcacgctggccctgcgaacactgggcagcttt
gaatttgaaggacattccctcacccagtttgtgcgccactgtgctgatcacttcttgaac
agcgagcataaggaaataaggatggaggcagctcgaacctgctcgcgcctgctcactcct
tccattcacctgatcagcggccatgttgtcagtcagactgctgtgcaggttgtcgcagat
gtgctcagcaagctgctcgtggttggcatcactgacccagatccagacatccggtactgt
gtgctggcctcacttgatgagcgttttgatgctcacctggcccaggccgagaacctacag
gcactatttgtcgcactgaatgatgaggttttcgagatcagagagttggccatctgcaca
atcggacgactcagcagcatgaaccctgcctatgttatgcccttcctgcgaaagatgctc
attcagatcttaacggagctggagcacagcggtgtcggcaggaacaaggagcagagcgct
cgtatgcttggtcacctggtctccaacgcccctcgtctcatacggccatatatggagccc
atcctcaaggctctaatcctcaaactgaaagacccagacccgaatcctggagtggtcata
agcgtcttggcaactattggagagttggctcaggtgagcggcttggaaatgagaaagtgg
atggatgagctttttccaatcatcatggacatgctgcaagactcgtcatcactggccaaa
cgacaagtggcgctgtggacgttgggccagcaagtggccagcacaggttatgtggtggag
ccttaccgcaagtacccctcccttctggaggtgctgctcaacttcctgaagacagaacag
aaccagggcatcaggagagaggctatacgtgttctgggtctcctgggcgcgctggacccc
tacaagcacaaggtgaacatcgggatgatcgaccagtcacgggacgcctctgccgtcagt
ctctctgagtcgaagtccagccaggactcagcggactacagcacgagtgagatgctagtg
aacatgggcaaccttcccctggatgagttttatccagctgtggccattgtcactttaatg
cgcatcctgagagacccctccctgtccaaccatcacacaatggtggtccaggctgtgacc
tttatctttaagtctctgggtctgaagtgtgtccagtttctgccccaggtcatgcccacg
ttcctaaatgtaattcgggtgtgtgatgccagtatccgagagttccttttccagcagatg
ggaatggtggtgtgctttgttaagatccacatccggccctacatggacgacatcttcacg
ctcatcagagagtactggacaccgaacaaccccatgcagaataccatcatccttctgatc
gagcagattgtggtggcactgggaggagaattcaagctttacctgcctcagcttatccca
cacatgctgcgcgtcttcatgcatgacaatagtactggtcgtagtgttaccatgaagtta
cttaatgccatccagctgtttggtgccaacttagatgactacctgcacttgctacttcct
ccgattgtcaaactgtttgatgctcctgatgtgcccctgcaagcccgcaaggttgccctg
gagacactggagcgcctcacagagtccctggacttcacggactatgcgtcacgcattatc
caccccatagttaggacacttgacagtacgccggaattgcgctccacctctatggacacc
ctgtcctcactagtgttccagttgggaaagaagtaccagatcttcatccccatggtgaat
aaagtgatgctgaagcacaggattaaccatcagcgttatgacatgctcatatgtcgcatc
gttaagggatatactctggctgaggaggaagaggacacaatcctccaacatcgccagtct
cgtggtaaaccaggcgacgcattggtcagcggaccggtggaggcagggcccatgaaaaag
cttcatgtcagcactaccgcacttcaaaaggcttggggcgctgccaggaaggtgtccaaa
gacgactggttggagtggctgcggcgcttaagtgtcgtcctgctcaaagagtcatcatcc
ccagctctccgatcgtgctggtccctggctcagacctacatccctcttgccagggacttg
ttcaacgccgccttcctctcttgttggtcggagctgagcgaggatcaacaggacgaactc
atccgcagcatcgagttagcgctcacctctcaggatatcgcagaggtcacacagactctg
ctcaacctggcggagtttatggaacacagcgacaagggtcctctacccctccgcgatgat
aatggcatcgtgctgcttggtgagagagcggccaagtgtcgagcttacgctaaagctttg
cattacaaagagctggagtttcaaaagggtccttcgccacttattctggagtctcttatc
agcatcaacaataaactgcagcagccagaagcagcgtcgggggtgctggactatgcaatg
aagcattttagtgaactggaaattcaagccacctggtacgagaagctacacgagtgggag
gatgccctggtagcttatgacaagaagatcgacatgaacaaagaggaccctgagctcatc
ctgggcaggatgcgctgcttagaggccctgggagaatggggccagttacaccagcagtgc
tgtgaggaatgggcactggtgagcgaggaaacccaggccaagatggcgcgcatggctgct
gccgccgcatggggtctaggacactgggacagcatggaggagtacacatgcatgatcccg
agagatacgcatgatggagcgttttacagagctgtgctggccctgcatcaggacctcttc
tcattggcccagcaatgtattgacaaagcaagggatctcctggacgctgagctgacagcc
atggctggagagagctacagtcgagcttatggggcaatggtgtcctgccagatgctgtca
gagctagaggaggtgatccagtacaagttggtcccagagaggagggacatcatcagggaa
acatggtgggagaggcttcagggttgtcagcgtatcgtagaagactggcaaaagatccta
atggtcagatctcttgtcatcagcccccatgaagacatgaggacttggctgaagtacgcc
agcctctgtggcaagagtggacgcctggcgctggcccataagacccttgtgcttcttctg
ggtgttgacccctctaagcagttggatcatccactgcccacagcccacccacacgtcacc
tacgcttacatgaagtacatgtggaagagttcccgcaagatcgatgccttccagcacatg
cagcacttcgtgcaaggtatgcagcagcaagcccagcacgctatcgcagctgaggatcag
cagcataagctggagctccacaaactgatggccagatgtttcctaaaactgggcgagtgg
cagctcagtttgcagggcatcaacgagagcaccattcctaaagtcctccagtattacagc
cattccacggagcatgaccgcaactggtacaaggcctggcacgcctgggcagtgatgaat
tttgaggctgtactgcactacaagcaccagaatcaaggacgggacgagaagaagaagctg
cgtcacggcagcggcgccagcgctaacagcgaagccagcaacagcgacagcgaggctgac
agcaccgatcacagtccctccccgggtcagaaaaaggtcaacgaggacctctcaaagacg
ttgctgctatacacagttcctgctgttcaaggcttcttccgctccatttccctttccaga
ggcaacaacctgcaggacaccctcagggttttgactttgtggtttgactatggccactgg
cctgaggtcaatgaagccttggtggagggcatcaagactatccagatagacacgtggcta
caggtgatccctcagctcatagctcgaattgacacaccacgagctctggtgggtcggctc
atccaccagctgctgacagacatcgggcggtaccatccacaagctttaatctacccgctg
accgtggcgtccaagtccacgaccaccgcccgccataatgctgctaataagatcctgaag
aacatgtgcgagcactgcaacaccctggtccagcaggccatcatggtgagcgaggagctt
atccgagtggccatcttgtggcacgagatgtggcatgaagggctcgaagaggcgtcacgc
ctgtactttggcgagcgcaacgtcaagggcatgtttgctgtgctagaacccctgcatgcc
atgatggagaggggaccacagaccctgaaagagacctcttttaaccaagcatatggtcgc
gatttgatggaggcgcaggactggtgcagaaaatacatgcgctctggaaatgtaaaagac
ttgactcaggcctgggacctgtattatcacgtgttcagacgcatctcaaaacaactccct
cagttgacctccttggagctacagtacgtgtctcccaagctgctgatgtgccgagacctg
gagctcgcagtaccaggcacttacgaccccaatcagcccatcatccgcattcagtctatc
gccgcttcgctgcaggtcatcacctccaagcagcgcccacgcaagctcaccatcatgggc
agcaacggccatgagttcatgttcctgttgaagggccacgaggacctgaggcaggacgag
agagtcatgcagctgttcggcctggttaacacgctgctcgccaatgaccccgcgtccttg
cgcaagaacctcagcatccagcgttacgcagtgatccctctgtccaccaactcgggcctg
attggatgggtgccccactgtgacacgctgcacgccctcatcagagactacagagagaag
aagaagattctgctcaacatcgagcatcgcatcatgctcaggatggccccagactacgac
cacctgaccctgatggagaaggtggaggtgttcgagcacgccgtcaacaacacggccgga
gacgacctcgccaagctcctgtggctcaagagccccagctccgaggtgtggtttgacaga
aggaccaattacacccgctccctggctgtcatgtccatggtgggctacatcctgggcctg
ggagacaggcatccctccaacctgatgttagaccgactgagcggaaagatcctccacatc
gacttcggggactgttttgaagtcgccatgaccagagagaagttccctgaaaagatcccg
ttcagactgacgaggatgctgaccaacgccatggaggtgacaggcctggatggaaactac
cgcatcacctgccacacagtgatggaggtgctgagggagcatcgcgacagcgtcatggcc
gtgctggaggcgttcgtctacgacccgctgctcaactggaggctcatggacacaaacacc
aaaggcaacaagcgctcccgcaccagaaacgactcatacaccgccggacaatcagtggag
gccctcgagggaatcgacctgggagagaccacgcacaagaaaccggggaacactgtaccc
gagtccatccactccttcattggagatggtttggtccaacctgaggcgctcaacaagaaa
gctattcagatcatcaacagggtgagagacaaactcacgggacgagacttttcccacgat
gacacgctggatgttcccacacaagtggagctcctcattaaacaggccacatcccacgaa
aacctgtgccagtgctacatcggatggtgccccttttggtga

DBGET integrated database retrieval system