KEGG   Takifugu rubripes (torafugu): 101074471Help
Entry
101074471         CDS       T02386                                 

Definition
tyrosine-protein phosphatase non-receptor type 7-like
Orthology
K18019  
tyrosine-protein phosphatase non-receptor type 7 [EC:3.1.3.48]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:tru04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 440 aa AA seqDB search
MARVHSDSPPAEDPGSPPPMTTPPRKASVRLQERRGSNLSLQLDVSSLGVEPICSVSTPK
EVWLQLLHTSSRPLKHAMLQQAARDTNMLNSEYQKIPPNFVTSAELDVPGHMIKDRYKTI
LPNPETRVILKSPEEDAGPDRYINANYIRGYNGAPQAFIATQGPLLHTVGDFWDMVWQEK
SRIIVMLTRLKENNEKCELYWPQPREVRTRVVKEEQEEGSEDLKEEEEEGRMVQFGRYIL
RVGDVQEKCGFTVTDIEVQLSEERHRVRHYWFTSWPDHHIPQCTAPLLRLVEEVEMYSDS
LSDTSAPGPVVVHCSAGIGRTGCFIVSSIGCRQLRETGQVDILEMVCQLRLDRGGMIQTT
EQYQFLYSTLAQYSSQLQPVYDYRISICKDNWKRNQIWMFPRKGQGLKKKKKKKKKTTSM
ENKMDNKSVVDPVKHERIQA
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggccagagtgcactcggactcccctccagctgaggatccaggcagccccccgcccatg
accacacccccccgcaaagcttcagtccgtctgcaggagaggcggggatcaaacctttcc
ctgcagttggatgtgagtagtttgggggtggagcccatctgctctgtctccaccccaaaa
gaagtgtggcttcagctgctccacacctcctcccgccccctcaaacacgccatgctgcag
caggctgccagggacacaaacatgctcaactctgaataccagaagatccctccaaacttt
gtgacctcggcagagctcgatgttcctggtcatatgattaaagacagatacaaaaccatc
ctacccaaccctgaaacccgggtgatactgaagagcccagaggaggacgctgggccagac
cgctacatcaatgccaactacatcaggggttacaatggagctccacaagccttcatcgcc
acacagggaccactgctgcacacggtaggagacttctgggatatggtgtggcaagagaag
agcagaatcatcgtcatgctcacgaggctcaaggagaacaacgagaaatgtgagctgtac
tggccacagccgcgggaggtgaggacaagggtggtgaaggaagagcaagaggagggcagt
gaagacctgaaggaggaagaggaggaagggaggatggtgcagtttggcagatatatcctc
agagtgggggacgtccaagagaaatgcgggttcactgtgactgatatagaagtccagctc
tctgaagagcgacatagagtccgacactactggttcacctcttggcctgaccaccacatc
ccacaatgcactgctcctctgttgagactggtggaggaggtagagatgtacagcgactcc
ctctctgacacaagcgctcctggacctgttgttgtccactgcagtgcgggcataggaagg
acaggttgctttattgtgagcagcattgggtgccggcagctccgagagacggggcaggtt
gacatcttggagatggtgtgccagctcagactggaccgtggtgggatgatccaaaccaca
gagcaataccagttcctgtactccacactggcccagtacagctcgcagctgcagcccgta
tacgactacagaatctccatttgtaaagacaactggaaaaggaaccagatatggatgttt
ccaaggaaaggtcaaggcctaaagaagaagaagaagaagaagaagaagaccacatcaatg
gagaataaaatggataataagtcagtggtggatcctgtcaagcatgagaggattcaggca
taa

DBGET integrated database retrieval system