KEGG   Takifugu rubripes (torafugu): 101074711Help
Entry
101074711         CDS       T02386                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase 4-like
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
tru  Takifugu rubripes (torafugu)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
9
AA seq 587 aa AA seqDB search
MLPEINNKKFGPGVGTLPQLEPPVVQVVLSNAKNQQSENILPQIANRGGQNNNQTQDERP
KPSQQFAMRFGTAMDKVSISRNSKGFSKKTEKDKSYEGQRLPLSPLEALKNFQDRLTRFE
QEEITDYSEIWFMGLSSHKIAGSQGTPQNCGYDDEHGSYIRVLHDHIAYRFEVLEVIGKG
SFGQVLKCLDHKNNELVAIKMIRNKKRFHHQALVELKILDVIKRKDKDNLHNVIHMKEYF
YFRNHLCISFELLGVNLYELIKKNNFQGFSIALIRRFTHALLRCLQMLHREKIIHCDLKP
ENILLSQRGPGNIKVVDFGSSCYEQQRVYTYIQSRFYRSPEVILGHPYSMAIDMWSLGCI
LAELYTGYPLFPGESEVEQIACIMEVLGMPPNDFAQSASRRRLFFDSKGNPRNVTNSKGK
KRIPNSNELSTALKTTDPLFLDFIKRCLTWDPTKRMTPNEGLQHEWILEGNFNKVRPRTK
PAVKKASESLTITENSSNEGLDSESGTTEKLKQESSVTGTKMGPTERLRPIGASAQEEVC
ENHGKLSAEPKYQERGGERPVHIIIKPQKDVETKESQERSQCMPPVN
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgttaccagaaattaacaacaagaagtttgggccaggtgttgggaccttgcctcagctt
gagcctccggtggtccaggtggtgctcagcaatgccaaaaatcaacagtcagaaaacatc
ctgccccaaattgccaacagagggggccaaaacaacaatcaaacccaggatgagaggcca
aagcccagccagcagtttgcaatgcgtttcggtacagcgatggataaagtctccatctcc
cggaacagcaaaggtttcagtaaaaaaacagaaaaagacaagtcatacgaagggcagaga
cttcccctatcccctctagaagcactcaagaacttccaggaccgactgacgaggtttgaa
caggaggaaatcacggattattcagagatctggttcatgggtctgagctctcacaagatc
gcgggatctcaaggcaccccgcagaactgcggctatgatgacgagcatgggagctatata
agggtgctgcatgaccacattgcctacaggtttgaagtccttgaagttattggaaaaggc
tcatttgggcaggtcctgaaatgtctggaccacaagaataacgagcttgtagccattaag
atgatacgcaacaagaaaaggtttcatcaccaggctctggttgagctgaagatcctggat
gtaataaagaggaaagacaaagacaacctgcacaatgtcattcacatgaaggagtacttc
tatttccgcaaccacctgtgcatctcatttgaactgctcggggtcaacttatatgaactc
attaaaaaaaacaacttccagggcttcagtattgctctcattcgtcgcttcacccatgct
cttctccggtgcctgcagatgcttcacagagagaagattatccactgtgaccttaaaccg
gaaaacatacttttgtctcagagaggtccaggaaacatcaaggtcgttgactttgggtca
agctgttatgaacaacaaagggtttacacctacatccagagtcgtttctatcgctctcct
gaagtcatcctgggtcacccctacagcatggccattgatatgtggagtctgggctgcatc
cttgctgaactctacacaggatatcccctcttcccaggagagagtgaagtagagcaaata
gcttgcataatggaggttcttggaatgcctcccaatgactttgctcagtcagcatcaagg
aggagactgttttttgactctaaaggaaatcccagaaatgtcaccaatagcaaggggaag
aaacggatacccaattccaacgaactgtctacggctttaaaaacaacagatccactgttc
ctagacttcattaaacggtgcctcacttgggatccaaccaagcgcatgacacctaatgag
ggactccaacatgaatggatcctggaagggaactttaacaaagtccgaccaagaaccaaa
ccagcggtcaagaaagcctcagagagtttaaccataacagaaaacagcagcaatgagggg
ttggactcagaaagcggcacgactgagaaattgaagcaagagagctcagtaacaggaaca
aagatggggccaactgagcgcctgagacccattggggcctcagcacaggaggaggtctgt
gagaaccatggaaagctttctgcagagcccaagtatcaagaaagaggtggagagaggccc
gttcacatcatcatcaaaccacaaaaggatgtagaaacaaaggaaagtcaagaaaggtct
caatgtatgcccccagttaactaa

DBGET integrated database retrieval system