KEGG   Takifugu rubripes (torafugu): 101074720Help
Entry
101074720         CDS       T02386                                 

Definition
general transcription factor IIH subunit 4-like
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    101074720
  Replication and repair
   03420 Nucleotide excision repair
    101074720
Transcription machinery [BR:tru03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     101074720
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 465 aa AA seqDB search
MKLHVQLQCKNLHQYLKELSPDILDRLYNHPATCLAVYRELPSLAKNFVMRMLFLDQPLP
QAAVSLWVNKDNQKDHDECVSVLAGLRLWHSQHLQGGLQGYILNPVFKDNLKIALLGGGR
AWADEGGTLGPDRHARDIGSLDRYATERWEVILHFMVGSPCAAVSQDLAQLLVHAGLMKS
EAGEPPYITSAGFQFLLLDTASQLWYFTLQYLKTAQSRGMDLVEILSFLFQLSFSTLGRD
YSVEGMSDSLLTFLQHLREFGLVFQRKRKSRRYYPTRLAITLATGDSSSSLHTPTASLAS
TPGSGDSGFIVVETNYRIYAYTNSELQIALVALFSEMLYRFPNVVVAQVTRESVQQAIAN
GITAQQIIHFLRTRAHPVMLRQTPFLPPTITDQIRLWELERDRLQFTEGVLYNQFLSQTD
FEVLRDRAKSLGCLVWQDAAHRVMVVTLWGHSEVKKFWKRQKSQM
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgcatgttcaactgcagtgcaagaatctgcatcaatacctcaaagagttgagt
cctgacattttggacagactctacaaccatccagcaacatgtctggctgtttacagagaa
ctgccgtctctggcaaagaactttgtgatgcgaatgctgttcctcgaccagccgctcccc
caggcagccgtgtcattatgggtcaacaaagacaatcagaaggatcacgatgaatgtgtg
tcggtgctggcaggacttcgcctttggcacagtcagcatctgcaaggaggtctacaagga
tacattttgaatccagtctttaaagataacctaaagattgccttgcttggagggggcaga
gcatgggccgacgaaggaggcactctgggtccagatcgccacgcccgggacatcggcagc
ctggaccgttacgccacagagcgctgggaggtcatcctgcatttcatggtgggttcaccc
tgcgctgccgtcagtcaagacctggcgcagctgctggttcacgcaggcctcatgaaaagt
gaagccggggagccaccttacatcacctcagctggtttccagttcctcctgttggacacg
gcctcccagctctggtacttcaccctccagtacctgaaaactgctcagtctagaggaatg
gatctagtggagatcctgtcattcctgttccagcttagtttctctactcttgggagagat
tattcagtggagggcatgagcgactcattgctgaccttcctgcagcacttacgggagttt
ggacttgtctttcagagaaagaggaagtctcggcgctactatcccaccagactggccatc
acactagccacaggcgactccagcagctccctgcacacccccacagccagcttggcctca
actcctggttctggtgactctggcttcatcgtggtagaaacaaactaccgcatctacgct
tacaccaattcagaacttcagattgctttggttgctttgttcagtgaaatgttgtatcgc
ttcccaaatgtggtggttgcccaggtgaccagggagtcagtacaacaggccatagccaac
ggtatcactgctcagcagattatccacttcctgaggacgagggctcatcctgtcatgctc
agacagactccgtttcttcctccaacaataacggatcaaatcagactgtgggagctggag
cgagatcggctgcagttcacagaaggagtgctctataaccagttcctgtcccaaacggac
tttgaggtgctgagagacagagccaagagcttgggctgtctggtgtggcaggacgcggct
cacagggtcatggtggtgacgctgtggggacacagcgaagtcaagaaattctggaaacga
caaaagtcccaaatgtaa

DBGET integrated database retrieval system