KEGG   Takifugu rubripes (torafugu): 101074729Help
Entry
101074729         CDS       T02386                                 

Gene name
dlat
Definition
(RefSeq) dihydrolipoamide S-acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru00010  Glycolysis / Gluconeogenesis
tru00020  Citrate cycle (TCA cycle)
tru00620  Pyruvate metabolism
tru01100  Metabolic pathways
tru01200  Carbon metabolism
Module
tru_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101074729 (dlat)
   00020 Citrate cycle (TCA cycle)
    101074729 (dlat)
   00620 Pyruvate metabolism
    101074729 (dlat)
Enzymes [BR:tru01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     101074729 (dlat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 101074729
NCBI-ProteinID: XP_003971216
Position
15
AA seq 632 aa AA seqDB search
MLRLILRLRPSAGRARPCVLPAGPAALGSRSVPGTSCLRRFHNGAGSRTLSVGSSLIRRG
SLLRYPQLTGSCRFYSLPPHQKVELPALSPTMQTGTIARWEKKEGDKINEGDLIAEVETD
KATVGFEMLEECYLAKILVPEGTRDVNIGAVICITVENPELIPAFKDVTLDSIKAAGVSP
SPSASAPPPPPASAAPAAPGSSYPSHLKITLPALSPTMTMGTVQRWEKKVGEKLGEGDLL
AEIETDKATIGFEVQEEGYLAKIMVPEGTRDVPLGTPLCIIVEKESDIAAFKDYVETGVA
EVSAPAPAPAPVPAAPTPGPAVAAAPPPGPRKGRVFVSPLAKKLAAEKGLDLSQVSGSGP
DGRITKKDIESFVPPKAAPAVAAAPAAPAAPAPPTAAGAPAGVFTDIPISNIRKVIAQRL
MQSKQTIPHYYLSVDVNMDQVLELRQELNDEVKAQNIKLSVNDFIIKASALACLKVPECN
SSWMDTVIRQNHVVDVSVAVSTVNGLITPIVFNAHTKGLSAISSDVSALAAKARDGKLQP
HEFQGGTFTISNLGMFGVKNFSAIINPPQSCILAVGGSEKRLMPSDNEKGFDVASVMSVT
LSCDHRVVDGAVGAQWLAEFRKFLEKPVTMLL
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgctccgtttgattctgcggctgaggccgtccgccgggcgcgcccgtccctgtgtcctc
ccagccgggcctgctgcacttggctcccgctcagtgcccggtaccagttgcttgaggcga
tttcacaacggagctgggtcccgaaccttgtctgtgggctccagtcttatccgcagaggg
tctctcctgcggtacccacagctgacaggctcatgccgcttctacagcctgcctccgcac
caaaaggtggagcttccagcgctgtcgcccaccatgcagacaggaacgattgcacgttgg
gagaagaaggagggagataaaatcaacgagggcgatcttatagcagaggtggagaccgac
aaggccaccgttgggttcgagatgctggaggagtgctaccttgctaagatcctggtacct
gaaggcaccagagacgttaacatcggggctgtaatctgcatcacggtagaaaaccccgag
ctcattcccgcctttaaggatgtaacgttggactccatcaaagcggccggtgtcagcccc
tcaccatctgcctctgctcctcctcctccaccggcttctgccgctcccgcggctccaggc
agctcgtacccctcgcacctgaagatcaccctccccgccctgtctcctaccatgaccatg
ggaacagtgcagcgctgggagaagaaggtgggagagaagctgggtgaaggcgatctgctg
gctgagatcgagaccgacaaggcgaccatcggttttgaggtgcaggaagagggatacttg
gccaaaatcatggtgcctgagggaactcgggatgttcccctcggaacgccgctctgcatc
atcgtggaaaaggaaagtgacatcgccgccttcaaagattatgttgagaccggagtggca
gaagtttccgctccggctccggcaccagctcccgtcccggccgctccgacacccggtcca
gctgtggcagctgccccccccccaggacccaggaaaggtcgcgtgttcgtcagtccactg
gccaagaaacttgctgccgagaaaggattggacctgtcccaggtcagcggttctggtcca
gatggccgcatcaccaagaaagacattgaaagctttgttccaccaaaggctgcacctgct
gtagccgctgctccagctgctccagctgctcctgcaccccccacagctgctggcgcacca
gccggggtcttcactgacatccccatcagcaacatccgcaaggtgatcgctcagaggttg
atgcagtccaagcaaaccatccctcactattatctgtctgtagacgtcaacatggatcaa
gtgctggagctccggcaggaactcaacgatgaagtgaaggctcagaacatcaagctcagt
gtgaatgatttcattatcaaagccagtgctctagcttgccttaaggttcctgagtgtaac
tcctcctggatggacacggtgatccgccagaaccatgtggttgacgtgagcgtagctgtg
agcacagtcaatggcctgattacacccatcgtcttcaacgcccacaccaaaggactctcg
gccatcagctctgacgtttccgccctggccgccaaagcaagagacggcaaactgcagccg
cacgagttccagggaggcactttcacgatctctaacttggggatgtttggcgtcaagaac
ttctctgcaataatcaacccccctcagtcctgcatcctcgccgtcgggggctcagagaaa
cgcctgatgccatccgataacgagaaaggattcgacgtcgccagcgtgatgtcggtgacg
ttgagttgcgaccaccgtgtggtcgacggcgccgtgggggcgcagtggctcgcggagttc
cgcaagttcctggagaagcctgtcaccatgctgttgtaa

DBGET integrated database retrieval system