KEGG   Takifugu rubripes (torafugu): 101074813Help
Entry
101074813         CDS       T02386                                 

Definition
protein-arginine deiminase type-2-like
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
tru  Takifugu rubripes (torafugu)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 673 aa AA seqDB search
MAHNRTLGLYCDQTISVVYVVGSDLLINSNRCAPPGTDFFSVKCTPNVQYIISPPPQETS
HLSPLPLSGDSMIIVRMSHASDTENESKLSVRYYGSDKKVLGTARLYLTALEISLDVDAD
RDGVVERNNPNKGSWKWGPNGHGAVLLVNCDCERTYWKTPDSEKTYISKVSDLKDMSLMV
LRTRGPAKLPNDYKLTLHISQSDAESVRVFRSKLTGKQNGDFTSFLNDYPLVLSREVLSQ
EVPYLGGDAEINFYVEGLRFTDKDFNGLISVNLSVLEPISERVPETPIFTDKVVFRVAPW
IMTPNTLDPLEVFVCSTADNYQFLKGMKNFVGKSGHKLKICYEYMNRGDRWMQDELEFGY
IDSPHQRFPVVLDSPRDGKLQDFPYKELLGPDFGYVTREPDRENISSLDSFGNLEVSPPV
TVNGKNYPFGRILIGVAFPTATKGRNMTKVVQDFLWAQKVQDPIALFSDWLYVGHVDEFM
TFVPAPDRKGFRLLLASPDAAFKLFRRLQSNGHGEAKLFEDLTDEESITVDEILNDDSFH
VQNMYVQSCINWNRDVLKRELGLEEEDIIDLPILFKLVVGTKHQDAYRALAYYPDMVNMI
VLGKHLGIPKPFGPKVDGHCALEAEMCSLMEGLGLKCTFIDDFASYHKLLGEVHCGSNVR
RGMFDFKWWNLEM
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggcacataatcggaccctcggcctttattgtgaccagactataagcgttgtgtacgtg
gttggatcggatcttcttataaattccaacagatgtgcacctccaggcactgacttcttc
tctgtcaaatgcacacccaatgtccagtacatcatcagccccccaccccaggagacatcc
cacctctctccactccctcttagtggagactcaatgataatcgtcaggatgagccatgcc
agtgatacagaaaatgaaagcaagctgtctgtaaggtactatgggtctgataaaaaagta
ctgggtacagcgcgcttgtacttaacagctcttgagatctccctggatgttgacgctgac
agagatggggttgtggagaggaataaccccaataaggggtcatggaaatggggtccaaat
gggcatggtgctgtcctattagtcaattgtgactgtgagcggacatactggaagactcca
gacagcgagaagacatatatttccaaagtgtctgatttaaaggatatgtctctcatggtg
ctgcggaccagaggtcccgccaagctcccaaacgactacaaactcactctgcacatttct
cagagtgatgcagagagcgttagagtgtttagatccaaactgactggcaaacaaaatggt
gactttacgtcctttttgaacgactatccactggttctgagcagagaagttctgtcccag
gaggttccttacctgggcggtgatgctgagattaacttttatgtggagggcctccgcttt
actgacaaagacttcaatgggctcattagcgtcaacctcagtgtgctggagcctatctct
gaacgtgttccggagacgcccattttcacagacaaggttgtgttcagagtggcgccttgg
atcatgacacccaacaccctcgaccctttggaggtctttgtgtgcagcacggctgataac
taccagttccttaaagggatgaaaaactttgttgggaagagcggccacaagcttaagatt
tgctatgaatacatgaacagaggggaccgttggatgcaggatgagttggaatttggctac
atcgactcacctcatcaacggtttcctgttgtcttggactcacctcgtgatgggaaactg
caagactttccttataaagagcttctgggccctgactttggctatgtgacgagggagcct
gacagagaaaacataagtagtctggactcgttcggtaacctggaggttagccctccagtt
actgtgaatggaaagaactatccctttggcagaatcctcattggtgtggcttttcccaca
gcaactaaaggacgaaacatgaccaaagtggttcaagacttcttgtgggctcagaaggtg
caggaccccattgctttattttccgactggctttatgtgggccatgttgacgaattcatg
acttttgtccctgcacccgacagaaagggtttccggctgttgctggcaagcccagatgca
gccttcaagctattcagaagattgcagagcaatggccatggtgaagcgaagctatttgag
gatttgacagatgaagaatcaataacagtggatgagatcctcaatgatgacagttttcat
gttcaaaacatgtatgttcagagttgcataaactggaacagagatgtactgaaaagagag
ctcggcctagaagaagaggacatcatcgacctgcccattctcttcaagttagtggttggc
acgaagcatcaggatgcatatagagcactggcctactacccagacatggtgaacatgatt
gtcttggggaaacaccttggcattccgaagccctttggcccaaaagttgatggccactgc
gcgttggaggcagagatgtgttccttgatggagggcttgggactcaaatgcacatttatc
gatgactttgcctcctaccacaaactactgggagaggtacactgtggttcaaatgtccgc
aggggaatgtttgacttcaagtggtggaacctagaaatgtga

DBGET integrated database retrieval system