KEGG   Takifugu rubripes (torafugu): 101074813Help
Entry
101074813         CDS       T02386                                 

Definition
(RefSeq) protein-arginine deiminase type-2-like
  KO
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     101074813
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
19
AA seq 676 aa AA seqDB search
MAHNRTLGLYCDQTISVVYVVGSDLLINSNRCAPPGTDFFSVKCTPNVQYIISPPPQETS
HLSPLPLSGDSMIIVRMSHASDTENESKLSVRYYGSDKKVLGTARLYLTALEISLDVDAD
RDGVVERNNPNKGSWKWGPNGHGAVLLVNCDCERTYWKTPDSEKTYISKVSDLKDMSLMV
LRTRGPAKLPNDYKLTLHISQSDAESVRVFRSKLTGKQNVTSYSFTSFLNDYPLVLSREV
LSQEVPYLGGDAEINFYVEGLRFTDKDFNGLISVNLSVLEPISERVPETPIFTDKVVFRV
APWIMTPNTLDPLEVFVCSTADNYQFLKGMKNFVGKSGHKLKICYEYMNRGDRWMQDELE
FGYIDSPHQRFPVVLDSPRDGKLQDFPYKELLGPDFGYVTREPDRENISSLDSFGNLEVS
PPVTVNGKNYPFGRILIGVAFPTATKGRNMTKVVQDFLWAQKVQDPIALFSDWLYVGHVD
EFMTFVPAPDRKGFRLLLASPDAAFKLFRRLQSNGHGEAKLFEDLTDEESITVDEILNDD
SFHVQNMYVQSCINWNRDVLKRELGLEEEDIIDLPILFKLVVGTKHQDAYRALAYYPDMV
NMIVLGKHLGIPKPFGPKVDGHCALEAEMCSLMEGLGLKCTFIDDFASYHKLLGEVHCGS
NVRRGMFDFKWWNLEM
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggcacataatcggaccctcggcctttattgtgaccagactataagcgttgtgtacgtg
gttggatcggatcttcttataaattccaacagatgtgcacctccaggcactgacttcttc
tctgtcaaatgcacacccaatgtccagtacatcatcagccccccaccccaggagacatcc
cacctctctccactccctcttagtggagactcaatgataatcgtcaggatgagccatgcc
agtgatacagaaaatgaaagcaagctgtctgtaaggtactatgggtctgataaaaaagta
ctgggtacagcgcgcttgtacttaacagctcttgagatctccctggatgttgacgctgac
agagatggggttgtggagaggaataaccccaataaggggtcatggaaatggggtccaaat
gggcatggtgctgtcctattagtcaattgtgactgtgagcggacatactggaagactcca
gacagcgagaagacatatatttccaaagtgtctgatttaaaggatatgtctctcatggtg
ctgcggaccagaggtcccgccaagctcccaaacgactacaaactcactctgcacatttct
cagagtgatgcagagagcgttagagtgtttagatccaaactgactggcaaacaaaatgtc
acttcgtacagctttacgtcctttttgaacgactatccactggttctgagcagagaagtt
ctgtcccaggaggttccttacctgggcggtgatgctgagattaacttttatgtggagggc
ctccgctttactgacaaagacttcaatgggctcattagcgtcaacctcagtgtgctggag
cctatctctgaacgtgttccggagacgcccattttcacagacaaggttgtgttcagagtg
gcgccttggatcatgacacccaacaccctcgaccctttggaggtctttgtgtgcagcacg
gctgataactaccagttccttaaagggatgaaaaactttgttgggaagagcggccacaag
cttaagatttgctatgaatacatgaacagaggggaccgttggatgcaggatgagttggaa
tttggctacatcgactcacctcatcaacggtttcctgttgtcttggactcacctcgtgat
gggaaactgcaagactttccttataaagagcttctgggccctgactttggctatgtgacg
agggagcctgacagagaaaacataagtagtctggactcgttcggtaacctggaggttagc
cctccagttactgtgaatggaaagaactatccctttggcagaatcctcattggtgtggct
tttcccacagcaactaaaggacgaaacatgaccaaagtggttcaagacttcttgtgggct
cagaaggtgcaggaccccattgctttattttccgactggctttatgtgggccatgttgac
gaattcatgacttttgtccctgcacccgacagaaagggtttccggctgttgctggcaagc
ccagatgcagccttcaagctattcagaagattgcagagcaatggccatggtgaagcgaag
ctatttgaggatttgacagatgaagaatcaataacagtggatgagatcctcaatgatgac
agttttcatgttcaaaacatgtatgttcagagttgcataaactggaacagagatgtactg
aaaagagagctcggcctagaagaagaggacatcatcgacctgcccattctcttcaagtta
gtggttggcacgaagcatcaggatgcatatagagcactggcctactacccagacatggtg
aacatgattgtcttggggaaacaccttggcattccgaagccctttggcccaaaagttgat
ggccactgcgcgttggaggcagagatgtgttccttgatggagggcttgggactcaaatgc
acatttatcgatgactttgcctcctaccacaaactactgggagaggtacactgtggttca
aatgtccgcaggggaatgtttgacttcaagtggtggaacctagaaatgtga

DBGET integrated database retrieval system