KEGG   Takifugu rubripes (torafugu): 101074823Help
Entry
101074823         CDS       T02386                                 

Gene name
usp30
Definition
(RefSeq) ubiquitin specific peptidase 30
  KO
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.4.19.12]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101074823 (usp30)
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101074823 (usp30)
Ubiquitin system [BR:tru04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    101074823 (usp30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
21
AA seq 500 aa AA seqDB search
MWCQPQSSDKLIAEFLGSGPIVGNKMSGNWSVIGGIAAAIAAGVYVLWGPVTERKKKKRG
MVPGLLNLGNTCFLNSLLQGLAACPSFICWLEKVLDSPMNKTCKENQLSATLLQLLKALS
NAEPGEEDLLDAGCLLDILRLYRWHISSSEEQDAHELFHVLTSSLEEERERLPKVPHFFD
MQSLETPPVQEKTLTCISRAPLHPIPNPWKFQHPFHGRLTSNMLCKRCGQQSPVRYDSFE
SLSLSIPLPQWGRPVSLDHCLQHFISSETIKEVDCDNCTKLHQETTVNETSPGNQRSTFV
KQLKLGKLPQCLCIHLQRLTWSSEGTLKRQEHVQFTEYLSMDRYKHNSTQRRIKHALNPA
QTENSGNSAGIPTINDTAVFCFAGDHQNNNKSFSNGTCSSVFFPSPTLNPQLSLAYDYSP
SQYLFQLTAVLVHHGDMHSGHFVTYRRSPSPPHLAFSSQWLWVSDDSVRKASLHEVLSSN
AYMLFYERVQRLNLVLHTEE
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtggtgccaaccacagagctccgataagcttattgcggagttccttggcagtggacct
atagtcggaaacaagatgtctggaaactggagcgtcattggtggaatagccgctgcaatt
gcagctggagtttacgttttgtggggcccagttactgaaagaaagaagaaaaaaagagga
atggttcctggtctgttgaacttggggaacacctgcttcctgaactctttgcttcagggt
ttagcagcatgtccgtctttcatttgctggctggagaaagttttagattcacccatgaat
aagacatgcaaagagaaccagctgtccgctactctgctacagcttctaaaagctctgtcg
aatgccgagcctggagaggaggatttgctggatgctggatgcctcctggatatcctcagg
ctgtatcggtggcacatcagctcgtctgaagaacaggatgcgcatgaactctttcatgtc
cttacatcttcgctggaggaggagcgggagcgcctacctaaagtccctcacttttttgat
atgcagtctctagaaactcctccagttcaagagaaaacactgacctgcataagtcgcgca
cctcttcatccaataccgaatccatggaagtttcagcatccttttcatggtcgattaaca
agcaacatgctgtgcaagcgctgtggacaacagagtccagtacgatatgattcatttgaa
agtctgtccctgtccattcccttgcctcagtggggtcgacctgtgtctttagatcactgt
ctccagcatttcatttcttcagaaactattaaagaagtggactgtgacaactgcacaaag
ctacatcaggagacaactgtaaatgagacgtctccaggaaaccagaggtcaacatttgtt
aagcagctaaagctgggaaagctccctcagtgtctttgcatccatttacaaagactgaca
tggtccagtgaaggaaccctgaaaagacaggagcatgtgcagttcacagagtacctgtca
atggaccgctacaaacacaattccacgcagaggaggatcaagcatgccctgaaccctgct
cagactgaaaattcaggcaattctgcagggataccaaccatcaatgacactgctgtgttc
tgttttgcaggtgaccatcaaaacaacaacaaatccttttctaatggcacctgctcatca
gtattctttccctctcccactctgaacccacagctcagcctcgcctatgactacagccct
tcacagtatctgttccagctcacagccgtgctggttcaccacggcgacatgcactcagga
catttcgtcacgtaccgccgtagcccttccccgcctcacctcgccttcagttctcagtgg
ctttgggtgtcggacgactcggtgcgaaaagccagcctgcacgaggtcctgtcttccaac
gcttacatgcttttctacgagcgggtgcaaagactgaacctcgttttgcacacagaagaa
taa

DBGET integrated database retrieval system