KEGG   Takifugu rubripes (torafugu): 101074931Help
Entry
101074931         CDS       T02386                                 

Gene name
itga8
Definition
(RefSeq) integrin subunit alpha 8
  KO
K06584  
integrin alpha 8
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101074931 (itga8)
   04514 Cell adhesion molecules (CAMs)
    101074931 (itga8)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101074931 (itga8)
  Cellular community - eukaryotes
   04510 Focal adhesion
    101074931 (itga8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
7
AA seq 1056 aa AA seqDB search
MERCVWDCVSSAGMFILALLSVFWTAPNGVWSFNIYAEHPTRYRGPDGSYFGYSVDFYQA
STDRNTISVLVGAPKANTSQPGIVEAGAVYYCPWPGLPDSCRQIPFDNSNNRMMKLNGTR
EPLEFKSHQWFGASVRTHKGKVVACAPLYHWRTVKLSGEKDPVGTCYVAVQNFSAYAEYS
PCRTNDPDPEGQGFCQAGFSVDFTKEGTLVVGGPGSFYWQGQVMTAGVAQILNGYSLKAV
LRRVPEEKHTRAAEDTHDDSYLGYSVAVGEFTGDSEQELIAGVPRGAQNFGYVAMINSTN
MTFIQNFTGEQMASYFGYSLAVADLNGDGTDDVLVGAPLYMEREIESYPREVGKVYLYLQ
LSPLTFSDPVPLTGTYTFGRFGTAIAPLGDLNQDGYNDVAVGCPFGGEERGGRVLIYNGH
PNVAAQGLRLSQELRAARSRAGGLSGYGFTLRGGQDLDNNKYPDLIVGAFGSGEVSVYRS
RAVVSAEASMDLIPRVLNPDDRQCHLPQTDIMATCLKVDVCASVSGVGIPSSVDLRAELQ
LDWLKGVRGGVKRVLFLDTQEPQRTMLLRLGHRRPRACSTHTIYLKEDDEFRDKLSPISL
ALNYSLVPPSHGQDLPPILNHYSSTFLQEQAYILLDCGDDNVCIPDLQLSATMDRSELLI
GDDNPVLLTITAVNRGEGAYEAELHALIPPEADYIGVKRSAEALSEPDCEYKTVNDSRMV
VCDLGNPMVAGTELTVGLRFSIQRLEDVGPMIGFAMQIHSSNKDEPHSNLVSLNLTIAAV
AELDLRGVSHPSQVVLPFPRWEPKEKPVKEDEVGPQVTHIYELHNFGPSSIQEAQLQVGW
PSRFRDQNLLYAMEIQTDGPISCKTNNSLNPLGLQVSSVQDTPELLGFLRNASAPHQRHR
RAASGSHGSVGKTLNCTNVSCLKITCLIGRLDRRQSAVVKIRSRLWVQTFLQHRNNPYIL
NSTVSFEVLSMPYQVQPSLLPKRATSMGTHVLWGTPDVSFAVPLWVIILAILLGLLVLAI
LTLAMWKCGFFDRAKPPGDDNVSDQEQLTADQTGDA
NT seq 3171 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttgtgtgtgggactgcgtttcctccgctgggatgtttattctcgctctgttg
tcggtgttttggacggcgccaaacggagtctggagttttaacatttacgcggagcatccc
acgcgttacaggggaccagatggaagttatttcggttattctgtagacttttatcaagcg
tctacggaccggaacacaatcagtgtcttggtgggggctcccaaggcaaacacctctcag
ccgggcattgtggaggctggtgccgtgtattactgcccctggcccggtctccctgacagc
tgcagacagatcccctttgacaactcaaataacagaatgatgaagctgaacggcaccagg
gagcctctggagttcaagtcccaccagtggtttggggcgtcggtcaggacgcacaaagga
aaagtggtggcatgcgctcctctctaccactggcggacggtgaagctgagcggggaaaag
gacccggtggggacctgttatgtggctgtccagaacttcagcgcctacgccgagtactcg
ccctgcaggaccaacgacccggacccagagggacaggggttctgccaggctggcttcagt
gtggatttcactaaggaaggaacactggtggtaggaggtcctggaagtttctactggcaa
ggtcaggtgatgacggcaggagtagcccagatactgaacggttactctttgaaagcggtg
ctgagacgagttccagaggagaaacacaccagggctgctgaggacacgcacgacgacagt
tatctcggttactctgtggccgtgggggagtttacaggagactctgaacaagaactaata
gccggagtcccacgtggagcgcagaactttggatacgtggcgatgatcaattccaccaat
atgaccttcatccagaacttcacaggggaacagatggcctcctactttggttactctctg
gctgtcgccgacctgaatggagacgggacggacgatgttctggtgggggcccccctctac
atggagagagaaattgagagctatcccagagaggtgggcaaggtgtacctgtacctgcag
ctgtccccactcaccttctccgatcctgttccgctgacggggacgtacaccttcggccgc
ttcgggacggctatagcacctctgggcgacctcaaccaggatggatacaatgacgtggcg
gtcggctgcccgtttggaggagaggagcgtggagggagagtactgatatataacggtcac
cccaacgtagccgcgcaaggcctgaggctgagccaggagctgagagcagcccgtagccgt
gccgggggtctctcaggatatgggttcacgctgcgaggaggccaagacttggacaataat
aagtatcctgatttaatcgtgggggcattcggctcgggcgaggtctcggtctacaggtct
cgggctgtggtttctgctgaagcttccatggacctgatccccagagttctgaaccccgac
gaccgacagtgtcatctgcctcaaacagacatcatggcgacctgcctgaaagtggacgtg
tgtgcatccgtgagcggagtggggatcccctcttctgtagacctgagagcagagctgcag
ctggactggctgaagggagtgaggggcggggttaagagggttctgttcctggacacccag
gagccccaacgcacgatgctccttcgactgggtcacagacgcccacgtgcatgctcgaca
cacaccatttacctgaaagaggatgatgagttcagggacaagctcagccccatctcgctg
gcgctgaactacagcttggttccgccttctcacggccaggacctccctcccatcctcaac
cattacagcagcaccttcctgcaagaacaagcctacatcctcctcgactgcggcgacgac
aacgtttgcatccccgacctccagctctctgccaccatggaccgctcagagctgctgatc
ggagacgataaccccgtcctgctgaccatcaccgcagtgaaccgaggagagggggcctat
gaggcagagctgcacgccctgatcccgccagaggccgactacatcggggtgaagcgcagc
gcggaggctctgtctgagcctgactgtgaatacaagacggtcaatgactccaggatggtg
gtgtgtgacctggggaacccgatggtggccggcacggagctgactgtcggtttgaggttt
tccatccagcggctggaagacgtggggccaatgatcggctttgcgatgcagatccacagc
tccaacaaagacgagcctcacagcaacctcgtcagtttgaacctgaccatcgctgccgtg
gctgagctggatctacgcggggtgtctcatccctctcaggtggtgctgccgttccctcgc
tgggagcccaaagagaagcctgttaaagaggacgaagtggggccacaagtgacgcacatc
tatgagctccataactttgggcccagcagcattcaggaggcccagctccaggttggctgg
ccgtcccgtttccgtgaccagaacctgctctacgccatggagattcaaaccgacggcccg
attagctgcaagacaaacaacagcctcaacccgctcggcctccaggtttcctccgtccag
gacacgcccgagctgctgggctttttgagaaacgccagcgcgcctcatcagcgccacaga
cgagccgcctccggctctcatggttctgtcggcaaaactctgaattgcaccaacgtctcc
tgtctgaagatcacgtgtctgatcggccgcttggatcggcggcagagcgccgtggtgaaa
attcgctccaggctgtgggtgcaaacgttcctgcagcaccgcaataacccctacatcctg
aactccaccgtgtccttcgaggtcctgtccatgccttaccaagtccagccgtctcttctg
cccaaacgcgccacctcgatggggacccacgtgctgtgggggacgcctgacgtgtcgttc
gcggttccgctctgggtcatcatcctggccatcctgctgggcctgctggtgctcgccatt
ctaaccttagcgatgtggaagtgcgggttctttgaccgggcaaagccgccaggtgacgac
aacgtttcggaccaggagcagctgactgctgatcagacaggcgacgcctaa

DBGET integrated database retrieval system