KEGG   Takifugu rubripes (torafugu): 101074931Help
Entry
101074931         CDS       T02386                                 

Definition
integrin alpha-8-like
Orthology
K06584  
integrin alpha 8
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101074931
   04514 Cell adhesion molecules (CAMs)
    101074931
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101074931
  Cell communication
   04510 Focal adhesion
    101074931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 1080 aa AA seqDB search
MTRGSSSPQMWGTAERRDPVTAGGLNSGQAYITCTPPPPPLSLSLSLCLPLFLSLSFNIY
AEHPTRYRGPDGSYFGYSVDFYQASTDRNTISVLVGAPKANTSQPGIVEAGAVYYCPWPG
LPDSCRQIPFDNSNNRMMKLNGTREPLEFKSHQWFGASVRTHKGKVVACAPLYHWRTVKL
SGEKDPVGTCYVAVQNFSAYAEYSPCRTNDPDPEGQGFCQAGFSVDFTKEGTLVVGGPGS
FYWQGQVMTAGVAQILNGYSLKAVLRRVPEEKHTRAAEDTHDDSYLGYSVAVGEFTGDSE
QELIAGVPRGAQNFGYVAMINSTNMTFIQNFTGEQMASYFGYSLAVADLNGDGTDDVLVG
APLYMEREIESYPREVGKVYLYLQLSPLTFSDPVPLTGTYTFGRFGTAIAPLGDLNQDGY
NDVAVGCPFGGEERGGRVLIYNGHPNVAAQGLRLSQELRAARSRAGGLSGYGFTLRGGQD
LDNNKYPDLIVGAFGSGEVSVYRSRAVVSAEASMDLIPRVLNPDDRQCHLPQTDIMATCL
KVDVCASVSGVGIPSSVDLRAELQLDWLKGVRGGVKRVLFLDTQEPQRTMLLRLGHRRPR
ACSTHTIYLKEDDEFRDKLSPISLALNYSLVPPSHGQDLPPILNHYSSTFLQEQAYILLD
CGDDNVCIPDLQLSATMDRSELLIGDDNPVLLTITAVNRGEGAYEAELHALIPPEADYIG
VKRSAEALSEPDCEYKTVNDSRMVVCDLGNPMVAGTELTVGLRFSIQRLEDVGPMIGFAM
QIHSSNKDEPHSNLVSLNLTIAAVAELDLRGVSHPSQVVLPFPRWEPKEKPVKEDEVGPQ
VTHIYELHNFGPSSIQEAQLQVGWPSRFRDQNLLYAMEIQTDGPISCKTNNSLNPLGLQV
SSVQDTPELLGFLRNASAPHQRHRRAASGSHGSVGKTLNCTNVSCLKITCLIGRLDRRQS
AVVKIRSRLWVQTFLQHRNNPYILNSTVSFEVLSMPYQVQPSLLPKRATSMGTHVLWGTP
DVSFAVPLWVIILAILLGLLVLAILTLAMWKCGFFDRAKPPGDDNVSDQEQLTADQTGDA
NT seq 3243 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcgggagcagctcccctcagatgtggggaaccgcggagcgcagagatccagtg
acagctgggggacttaactctggacaagcctacatcacctgcacccccccccccccccct
ctctctctctctctctctctctgtctccccctctttctctctctctcttttaacatttac
gcggagcatcccacgcgttacaggggaccagatggaagttatttcggttattctgtagac
ttttatcaagcgtctacggaccggaacacaatcagtgtcttggtgggggctcccaaggca
aacacctctcagccgggcattgtggaggctggtgccgtgtattactgcccctggcccggt
ctccctgacagctgcagacagatcccctttgacaactcaaataacagaatgatgaagctg
aacggcaccagggagcctctggagttcaagtcccaccagtggtttggggcgtcggtcagg
acgcacaaaggaaaagtggtggcatgcgctcctctctaccactggcggacggtgaagctg
agcggggaaaaggacccggtggggacctgttatgtggctgtccagaacttcagcgcctac
gccgagtactcgccctgcaggaccaacgacccggacccagagggacaggggttctgccag
gctggcttcagtgtggatttcactaaggaaggaacactggtggtaggaggtcctggaagt
ttctactggcaaggtcaggtgatgacggcaggagtagcccagatactgaacggttactct
ttgaaagcggtgctgagacgagttccagaggagaaacacaccagggctgctgaggacacg
cacgacgacagttatctcggttactctgtggccgtgggggagtttacaggagactctgaa
caagaactaatagccggagtcccacgtggagcgcagaactttggatacgtggcgatgatc
aattccaccaatatgaccttcatccagaacttcacaggggaacagatggcctcctacttt
ggttactctctggctgtcgccgacctgaatggagacgggacggacgatgttctggtgggg
gcccccctctacatggagagagaaattgagagctatcccagagaggtgggcaaggtgtac
ctgtacctgcagctgtccccactcaccttctccgatcctgttccgctgacggggacgtac
accttcggccgcttcgggacggctatagcacctctgggcgacctcaaccaggatggatac
aatgacgtggcggtcggctgcccgtttggaggagaggagcgtggagggagagtactgata
tataacggtcaccccaacgtagccgcgcaaggcctgaggctgagccaggagctgagagca
gcccgtagccgtgccgggggtctctcaggatatgggttcacgctgcgaggaggccaagac
ttggacaataataagtatcctgatttaatcgtgggggcattcggctcgggcgaggtctcg
gtctacaggtctcgggctgtggtttctgctgaagcttccatggacctgatccccagagtt
ctgaaccccgacgaccgacagtgtcatctgcctcaaacagacatcatggcgacctgcctg
aaagtggacgtgtgtgcatccgtgagcggagtggggatcccctcttctgtagacctgaga
gcagagctgcagctggactggctgaagggagtgaggggcggggttaagagggttctgttc
ctggacacccaggagccccaacgcacgatgctccttcgactgggtcacagacgcccacgt
gcatgctcgacacacaccatttacctgaaagaggatgatgagttcagggacaagctcagc
cccatctcgctggcgctgaactacagcttggttccgccttctcacggccaggacctccct
cccatcctcaaccattacagcagcaccttcctgcaagaacaagcctacatcctcctcgac
tgcggcgacgacaacgtttgcatccccgacctccagctctctgccaccatggaccgctca
gagctgctgatcggagacgataaccccgtcctgctgaccatcaccgcagtgaaccgagga
gagggggcctatgaggcagagctgcacgccctgatcccgccagaggccgactacatcggg
gtgaagcgcagcgcggaggctctgtctgagcctgactgtgaatacaagacggtcaatgac
tccaggatggtggtgtgtgacctggggaacccgatggtggccggcacggagctgactgtc
ggtttgaggttttccatccagcggctggaagacgtggggccaatgatcggctttgcgatg
cagatccacagctccaacaaagacgagcctcacagcaacctcgtcagtttgaacctgacc
atcgctgccgtggctgagctggatctacgcggggtgtctcatccctctcaggtggtgctg
ccgttccctcgctgggagcccaaagagaagcctgttaaagaggacgaagtggggccacaa
gtgacgcacatctatgagctccataactttgggcccagcagcattcaggaggcccagctc
caggttggctggccgtcccgtttccgtgaccagaacctgctctacgccatggagattcaa
accgacggcccgattagctgcaagacaaacaacagcctcaacccgctcggcctccaggtt
tcctccgtccaggacacgcccgagctgctgggctttttgagaaacgccagcgcgcctcat
cagcgccacagacgagccgcctccggctctcatggttctgtcggcaaaactctgaattgc
accaacgtctcctgtctgaagatcacgtgtctgatcggccgcttggatcggcggcagagc
gccgtggtgaaaattcgctccaggctgtgggtgcaaacgttcctgcagcaccgcaataac
ccctacatcctgaactccaccgtgtccttcgaggtcctgtccatgccttaccaagtccag
ccgtctcttctgcccaaacgcgccacctcgatggggacccacgtgctgtgggggacgcct
gacgtgtcgttcgcggttccgctctgggtcatcatcctggccatcctgctgggcctgctg
gtgctcgccattctaaccttagcgatgtggaagtgcgggttctttgaccgggcaaagccg
ccaggtgacgacaacgtttcggaccaggagcagctgactgctgatcagacaggcgacgcc
taa

DBGET integrated database retrieval system