KEGG   Takifugu rubripes (torafugu): 101074931Help
Entry
101074931         CDS       T02386                                 

Gene name
itga8
Definition
(RefSeq) integrin, alpha 8
  KO
K06584  
integrin alpha 8
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101074931 (itga8)
   04514 Cell adhesion molecules (CAMs)
    101074931 (itga8)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101074931 (itga8)
  Cellular community
   04510 Focal adhesion
    101074931 (itga8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
7
AA seq 1056 aa AA seqDB search
MERCVWDCVSSAGMFILALLSVFWTAPNGVWSFNIYAEHPTRYRGPDGSYFGYSVDFYQA
STDRNTISVLVGAPKANTSQPGIVEAGAVYYCPWPGLPDSCRQIPFDNSNNRMMKLNGTR
EPLEFKSHQWFGASVRTHKGKVVACAPLYHWRTVKLSGEKDPVGTCYVAVQNFSAYAEYS
PCRTNDPDPEGQGFCQAGFSVDFTKEGTLVVGGPGSFYWQGQVMTAGVAQILNGYSLKAV
LRRVPEEKHTRAAEDTHDDSYLGYSVAVGEFTGDSEQELIAGVPRGAQNFGYVAMINSTN
MTFIQNFTGEQMASYFGYSLAVADLNGDGTDDVLVGAPLYMEREIESYPREVGKVYLYLQ
LSPLTFSDPVPLTGTYTFGRFGTAIAPLGDLNQDGYNDVAVGCPFGGEERGGRVLIYNGH
PNVAAQGLRLSQELRAARSRAGGLSGYGFTLRGGQDLDNNKYPDLIVGAFGSGEVSVYRS
RAVVSAEASMDLIPRVLNPDDRQCHLPQTDIMATCLKVDVCASVSGVGIPSSVDLRAELQ
LDWLKGVRGGVKRVLFLDTQEPQRTMLLRLGHRRPRACSTHTIYLKEDDEFRDKLSPISL
ALNYSLVPPSHGQDLPPILNHYSSTFLQEQAYILLDCGDDNVCIPDLQLSATMDRSELLI
GDDNPVLLTITAVNRGEGAYEAELHALIPPEADYIGVKRSAEALSEPDCEYKTVNDSRMV
VCDLGNPMVAGTELTVGLRFSIQRLEDVGPMIGFAMQIHSSNKDEPHSNLVSLNLTIAAV
AELDLRGVSHPSQVVLPFPRWEPKEKPVKEDEVGPQVTHIYELHNFGPSSIQEAQLQVGW
PSRFRDQNLLYAMEIQTDGPISCKTNNSLNPLGLQVSSVQDTPELLGFLRNASAPHQRHR
RAASGSHGSVGKTLNCTNVSCLKITCLIGRLDRRQSAVVKIRSRLWVQTFLQHRNNPYIL
NSTVSFEVLSMPYQVQPSLLPKRATSMGTHVLWGTPDVSFAVPLWVIILAILLGLLVLAI
LTLAMWKCGFFDRAKPPGDDNVSDQEQLTADQTGDA
NT seq 3171 nt NT seq  +upstreamnt  +downstreamnt
atggagcgttgtgtgtgggactgcgtttcctccgctgggatgtttattctcgctctgttg
tcggtgttttggacggcgccaaacggagtctggagttttaacatttacgcggagcatccc
acgcgttacaggggaccagatggaagttatttcggttattctgtagacttttatcaagcg
tctacggaccggaacacaatcagtgtcttggtgggggctcccaaggcaaacacctctcag
ccgggcattgtggaggctggtgccgtgtattactgcccctggcccggtctccctgacagc
tgcagacagatcccctttgacaactcaaataacagaatgatgaagctgaacggcaccagg
gagcctctggagttcaagtcccaccagtggtttggggcgtcggtcaggacgcacaaagga
aaagtggtggcatgcgctcctctctaccactggcggacggtgaagctgagcggggaaaag
gacccggtggggacctgttatgtggctgtccagaacttcagcgcctacgccgagtactcg
ccctgcaggaccaacgacccggacccagagggacaggggttctgccaggctggcttcagt
gtggatttcactaaggaaggaacactggtggtaggaggtcctggaagtttctactggcaa
ggtcaggtgatgacggcaggagtagcccagatactgaacggttactctttgaaagcggtg
ctgagacgagttccagaggagaaacacaccagggctgctgaggacacgcacgacgacagt
tatctcggttactctgtggccgtgggggagtttacaggagactctgaacaagaactaata
gccggagtcccacgtggagcgcagaactttggatacgtggcgatgatcaattccaccaat
atgaccttcatccagaacttcacaggggaacagatggcctcctactttggttactctctg
gctgtcgccgacctgaatggagacgggacggacgatgttctggtgggggcccccctctac
atggagagagaaattgagagctatcccagagaggtgggcaaggtgtacctgtacctgcag
ctgtccccactcaccttctccgatcctgttccgctgacggggacgtacaccttcggccgc
ttcgggacggctatagcacctctgggcgacctcaaccaggatggatacaatgacgtggcg
gtcggctgcccgtttggaggagaggagcgtggagggagagtactgatatataacggtcac
cccaacgtagccgcgcaaggcctgaggctgagccaggagctgagagcagcccgtagccgt
gccgggggtctctcaggatatgggttcacgctgcgaggaggccaagacttggacaataat
aagtatcctgatttaatcgtgggggcattcggctcgggcgaggtctcggtctacaggtct
cgggctgtggtttctgctgaagcttccatggacctgatccccagagttctgaaccccgac
gaccgacagtgtcatctgcctcaaacagacatcatggcgacctgcctgaaagtggacgtg
tgtgcatccgtgagcggagtggggatcccctcttctgtagacctgagagcagagctgcag
ctggactggctgaagggagtgaggggcggggttaagagggttctgttcctggacacccag
gagccccaacgcacgatgctccttcgactgggtcacagacgcccacgtgcatgctcgaca
cacaccatttacctgaaagaggatgatgagttcagggacaagctcagccccatctcgctg
gcgctgaactacagcttggttccgccttctcacggccaggacctccctcccatcctcaac
cattacagcagcaccttcctgcaagaacaagcctacatcctcctcgactgcggcgacgac
aacgtttgcatccccgacctccagctctctgccaccatggaccgctcagagctgctgatc
ggagacgataaccccgtcctgctgaccatcaccgcagtgaaccgaggagagggggcctat
gaggcagagctgcacgccctgatcccgccagaggccgactacatcggggtgaagcgcagc
gcggaggctctgtctgagcctgactgtgaatacaagacggtcaatgactccaggatggtg
gtgtgtgacctggggaacccgatggtggccggcacggagctgactgtcggtttgaggttt
tccatccagcggctggaagacgtggggccaatgatcggctttgcgatgcagatccacagc
tccaacaaagacgagcctcacagcaacctcgtcagtttgaacctgaccatcgctgccgtg
gctgagctggatctacgcggggtgtctcatccctctcaggtggtgctgccgttccctcgc
tgggagcccaaagagaagcctgttaaagaggacgaagtggggccacaagtgacgcacatc
tatgagctccataactttgggcccagcagcattcaggaggcccagctccaggttggctgg
ccgtcccgtttccgtgaccagaacctgctctacgccatggagattcaaaccgacggcccg
attagctgcaagacaaacaacagcctcaacccgctcggcctccaggtttcctccgtccag
gacacgcccgagctgctgggctttttgagaaacgccagcgcgcctcatcagcgccacaga
cgagccgcctccggctctcatggttctgtcggcaaaactctgaattgcaccaacgtctcc
tgtctgaagatcacgtgtctgatcggccgcttggatcggcggcagagcgccgtggtgaaa
attcgctccaggctgtgggtgcaaacgttcctgcagcaccgcaataacccctacatcctg
aactccaccgtgtccttcgaggtcctgtccatgccttaccaagtccagccgtctcttctg
cccaaacgcgccacctcgatggggacccacgtgctgtgggggacgcctgacgtgtcgttc
gcggttccgctctgggtcatcatcctggccatcctgctgggcctgctggtgctcgccatt
ctaaccttagcgatgtggaagtgcgggttctttgaccgggcaaagccgccaggtgacgac
aacgtttcggaccaggagcagctgactgctgatcagacaggcgacgcctaa

DBGET integrated database retrieval system