KEGG   Takifugu rubripes (torafugu): 101075040Help
Entry
101075040         CDS       T02386                                 

Gene name
pak2
Definition
(RefSeq) p21 (RAC1) activated kinase 2
  KO
K04410  p21-activated kinase 2 [EC:2.7.11.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04010  MAPK signaling pathway
tru04012  ErbB signaling pathway
tru04510  Focal adhesion
tru04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101075040 (pak2)
   04012 ErbB signaling pathway
    101075040 (pak2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    101075040 (pak2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    101075040 (pak2)
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101075040 (pak2)
Protein kinases [BR:tru01001]
 Serine/threonine kinases: STE group
  STE20 family
   101075040 (pak2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PBD Kinase-like APH Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 101075040
NCBI-ProteinID: XP_003973904
UniProt: H2UX21
Position
20
AA seq 530 aa AA seqDB search
MCDNGESEDKPPAPPVRMSSTIFSTGSGKDSLSANHSSKPLPSVPEERKPRNKIISIFSG
AEKSGRKKDRDKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQK
KNPQAVLDVLKFYDSTGNGRQKYLSFSSSEKDAFTPGPQSPVKKGTEPSSANIKDIDDDD
DDETPPPVVAPRPEHTKSVYTRSVIDPIPAPNPCVDGDVASKAADRQKKKGKMSDEEIMD
KLRTIVSIGDPKKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINE
ILVMKELKNPNIVNFLDSFLMGEELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQ
ALDFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEV
VTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFR
DFLNCCLEMDVEKRGGSKELLQHPFLKLAKPLSSLTPLILAAKEAMKGNR
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgataacggcgaatctgaggataaaccccccgcccctccggtccgcatgagcagc
accatcttcagcaccggttccggcaaagactccctctcggccaaccacagctccaaaccg
ctgccgtctgtgcccgaggagagaaaacctcggaacaaaatcatctcaatcttttctgga
gccgaaaaaagtggtaggaagaaggatcgggacaaggagcgaccggagatttcgccgcct
tcagactttgaacacaccatacacgttggctttgacgccgtcactggggagttcactggc
atgccggagcaatgggcccgactgctccagacgtcaaacatcaccaagtcggagcagaag
aaaaacccacaggctgtgctggacgttctcaaattttacgactcgacaggcaacggtcgg
cagaagtacctcagcttttcctcctctgaaaaagacgctttcacaccaggccctcagtct
cccgtcaagaaaggcaccgaaccctcctctgcaaatatcaaagacatcgacgatgacgac
gacgacgaaactcctcctcctgtcgtggcaccgagaccggagcacacaaagagtgtgtac
actcgctcggtgatcgatccgatccctgccccaaatccctgcgtggacggcgacgtggct
tccaaggctgcagacaggcagaaaaagaagggcaagatgtctgatgaggaaatcatggat
aaactgagaaccatcgtgagcatcggagaccccaagaagaaatacaccagatacgaaaaa
attggtcagggtgcatctggaaccgtcttcacagccatcgatgtggctactggccaggag
gtggccattaaacagatcaaccttcagaagcagcccaagaaggagctgatcatcaatgag
attctggtgatgaaggagctgaagaaccccaacatcgtcaacttcttagacagtttcctg
atgggggaggagctgtttgtggtgatggagtacctggccggcgggtcgctgacagatgtg
gtcacggagacctgcatggacgaggcccagatcgctgctgtctgccgagagtgtttacaa
gccttggatttcctgcacgccaaccaggtcattcacagagacatcaaaagtgacaatgtg
ttactcggaatggacggttctgtcaagctgaccgacttcggcttctgcgcccagatcact
ccagagcaaagcaaacgcagcaccatggtaggaacgccttactggatggctcctgaggtg
gtgacccggaaggcttacgggcccaaagtcgacatttggtcactgggtattatggccatt
gagatggtggaaggagagcccccctacctgaacgagaacccgctacgagcgttgtacctg
attgccacaaatggcacgcccgagctccagaacccagagaagctgtccccggtgttcaga
gacttcctcaactgttgcctggagatggacgtagagaaacgaggcggcagcaaagagctg
ctccagcatcctttcctgaagctggcgaagcccctctccagtctcacacctctcatcctg
gccgccaaggaggccatgaagggcaatcgttaa

DBGET integrated database retrieval system