KEGG   Takifugu rubripes (torafugu): 101075040Help
Entry
101075040         CDS       T02386                                 

Definition
serine/threonine-protein kinase PAK 2-like
Orthology
K04410  
p21-activated kinase 2 [EC:2.7.11.1]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Focal adhesion
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101075040
   04012 ErbB signaling pathway
    101075040
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101075040
  Cellular commiunity
   04510 Focal adhesion
    101075040
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101075040
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: STE group
  STE20 family
   101075040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
20
AA seq 530 aa AA seqDB search
MCDNGESEDKPPAPPVRMSSTIFSTGSGKDSLSANHSSKPLPSVPEERKPRNKIISIFSG
AEKSGRKKDRDKERPEISPPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQK
KNPQAVLDVLKFYDSTGNGRQKYLSFSSSEKDAFTPGPQSPVKKGTEPSSANIKDIDDDD
DDETPPPVVAPRPEHTKSVYTRSVIDPIPAPNPCVDGDVASKAADRQKKKGKMSDEEIMD
KLRTIVSIGDPKKKYTRYEKIGQGASGTVFTAIDVATGQEVAIKQINLQKQPKKELIINE
ILVMKELKNPNIVNFLDSFLMGEELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQ
ALDFLHANQVIHRDIKSDNVLLGMDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEV
VTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRALYLIATNGTPELQNPEKLSPVFR
DFLNCCLEMDVEKRGGSKELLQHPFLKLAKPLSSLTPLILAAKEAMKGNR
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgataacggcgaatctgaggataaaccccccgcccctccggtccgcatgagcagc
accatcttcagcaccggttccggcaaagactccctctcggccaaccacagctccaaaccg
ctgccgtctgtgcccgaggagagaaaacctcggaacaaaatcatctcaatcttttctgga
gccgaaaaaagtggtaggaagaaggatcgggacaaggagcgaccggagatttcgccgcct
tcagactttgaacacaccatacacgttggctttgacgccgtcactggggagttcactggc
atgccggagcaatgggcccgactgctccagacgtcaaacatcaccaagtcggagcagaag
aaaaacccacaggctgtgctggacgttctcaaattttacgactcgacaggcaacggtcgg
cagaagtacctcagcttttcctcctctgaaaaagacgctttcacaccaggccctcagtct
cccgtcaagaaaggcaccgaaccctcctctgcaaatatcaaagacatcgacgatgacgac
gacgacgaaactcctcctcctgtcgtggcaccgagaccggagcacacaaagagtgtgtac
actcgctcggtgatcgatccgatccctgccccaaatccctgcgtggacggcgacgtggct
tccaaggctgcagacaggcagaaaaagaagggcaagatgtctgatgaggaaatcatggat
aaactgagaaccatcgtgagcatcggagaccccaagaagaaatacaccagatacgaaaaa
attggtcagggtgcatctggaaccgtcttcacagccatcgatgtggctactggccaggag
gtggccattaaacagatcaaccttcagaagcagcccaagaaggagctgatcatcaatgag
attctggtgatgaaggagctgaagaaccccaacatcgtcaacttcttagacagtttcctg
atgggggaggagctgtttgtggtgatggagtacctggccggcgggtcgctgacagatgtg
gtcacggagacctgcatggacgaggcccagatcgctgctgtctgccgagagtgtttacaa
gccttggatttcctgcacgccaaccaggtcattcacagagacatcaaaagtgacaatgtg
ttactcggaatggacggttctgtcaagctgaccgacttcggcttctgcgcccagatcact
ccagagcaaagcaaacgcagcaccatggtaggaacgccttactggatggctcctgaggtg
gtgacccggaaggcttacgggcccaaagtcgacatttggtcactgggtattatggccatt
gagatggtggaaggagagcccccctacctgaacgagaacccgctacgagcgttgtacctg
attgccacaaatggcacgcccgagctccagaacccagagaagctgtccccggtgttcaga
gacttcctcaactgttgcctggagatggacgtagagaaacgaggcggcagcaaagagctg
ctccagcatcctttcctgaagctggcgaagcccctctccagtctcacacctctcatcctg
gccgccaaggaggccatgaagggcaatcgttaa

DBGET integrated database retrieval system