KEGG   Takifugu rubripes (torafugu): 101075200Help
Entry
101075200         CDS       T02386                                 

Definition
histone-lysine N-methyltransferase SETDB1-B-like
Orthology
K11421  
histone-lysine N-methyltransferase SETDB [EC:2.1.1.43]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101075200
Enzymes [BR:tru01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101075200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1234 aa AA seqDB search
MEVDGWDPSLEEELGVSLDELRKWIEEAVEKSEIVQKKKAQLSELQQLVEKKEEEEAQTE
SLLIDARQSIKECEKLVKAAYQKNGLVYQESSSEEDGEEGCPLSPEVIEIDDEEDDDDVI
AVGCLVPPQKTAALSKDPLATEALTALQKTSQQVQNLAQVGTXSGRVGWGSPLFSFGPPG
VQSSAPAVFVSQVPAQSITQPNPNVSEDKLRIGMNILGKKRTKTWHRGALIAITPIGNGV
FKYKVKFDKGKSLLSGNHIAFDYNPTLEVLYVGARVVAKYKDGNLVWLYAGIVAEMPNNK
NRMRFLIFFDDGYASYVTLPELFPVCRPLRRTWEDIEDASCRDFIEEYITAYPSRPMVLL
KVGQIIKTEWEGTWWKSKVEEVDGSLVKILFLDDKRSEWIYRGSTRLEPMFNLKMTTANT
QEXKLAGQQRXRPNMGALRSKGPVVQYTSDGPVGASPVKGPPTSPSQPPLTSPQVPRPPP
PQPQQAPQTPQPSQLQRVDSKHQMAKKSTSPFVPGVGGTHASKIMHSLSSSPSNLATVKT
ANVPIAATPTPALLYPKQQPAPNPPLVPPATTTIPHQPAYRAPTDRIFYLPHTCQPACLK
RVRPVRQDFHRGKNPLLTPLLYDFRRMTGRRKVNRKMSFHVIYKAPCGLCLRNMSEIQHY
LFQTNCDFIFLEMFCLDPYVLVDRPFQPQRPFYYIPDITSGREDIPLSCVNEIDSTPPPK
VAYSKERIPEDGVFINTSDDFLVGCDCTDGCRDKSKCSCHQLTCQATGCTPGGQINQNAG
YLYKRLEECLPTGIYECNKRCKCCPQMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDVA
KGSFVCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESEAHCSDSEGSGV
DVSKMKIQPSALVSSNPLGRQTKKRECSSLKTVREEKSSSEDSDDGDDKDSKSEEESDSS
DDTFIKDSYYSSSSVWRSYTTRGQVKGNKEGSQDSKDGLNPSTKGTDEDKPPAMPEETGK
SKVASWLNQGLKTVSTDIGTRSGYRVPSQDVMTLSDSDDVQTISSGSDDNKEKEKVTLGV
TKKQVAVKSTRGIALKAGHGMMVKTGTPGGGGGGGGPGGGSKTGQQGHSGGGGDNAHRNT
RLFFDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRA
GTELTWDYNYEVGSVVGKVLLCCCGSTECRGRLL
NT seq 3705 nt NT seq  +upstreamnt  +downstreamnt
atggaggtggatggctgggaccccagtctggaggaagagctgggtgtttctctggacgag
ctccggaagtggatcgaagaggccgtggaaaagagcgaaatcgtgcagaagaaaaaggct
cagttgtccgagctccagcaactggtggagaagaaagaggaagaggaggcgcagacggag
tcgcttcttatagatgccaggcagtccataaaggagtgtgagaaactggtgaaggcagct
taccagaaaaacggcctcgtttaccaggagagcagctcggaggaggacggggaggaagga
tgcccgctgtcccccgaggtcatcgagatcgacgacgaggaggacgacgatgacgtcatc
gctgttggctgtctggttcctccacagaagacggcggctctgagcaaagatccactggcc
actgaggctctcacagccttacagaaaacctctcagcaggtccagaatttggcccaggtc
ggcacctgatccggtcgcgttggatgggggtcaccgctgttttcttttggacctccaggt
gtccagagttcagcaccggccgtgtttgtgtcccaggtcccggctcagtccataacacag
ccaaaccccaacgtgtcagaagacaagctcagaatcgggatgaacattttagggaagaaa
cggaccaagacctggcaccgaggagcgcttatcgccatcacccctattggaaatggtgtg
ttcaagtacaaggtgaagttcgacaaaggaaaaagtctgttgtccggaaatcacattgct
tttgactacaaccccaccctggaggttctgtatgttggcgctcgtgtcgtggccaagtac
aaggacggcaacctggtgtggctttatgctggaatagtagcggagatgcccaacaacaag
aaccgaatgaggtttttaatcttctttgatgatggatacgcgtcctacgtgaccttacct
gagctcttccccgtgtgtcgaccgctgcggcgtacctgggaggacatcgaggacgcgtcc
tgccgagacttcatcgaggagtacataacggcctaccccagcaggcccatggtgctcctg
aaagtaggacagatcatcaagaccgagtgggaagggacgtggtggaagagcaaagtggag
gaagtggatggaagcttggtcaagatcctcttcttggatgacaagaggagcgagtggatc
tacaggggctccaccaggctggaacccatgttcaacctgaagatgaccacagccaacacg
caggagnagaagctggcaggccagcagagancgcgacccaacatgggagcgctgaggagc
aaaggcccggtggttcagtacacgagcgatggacctgttggagcttctcctgtcaaaggt
ccaccgacgtcgcccagtcagcctccactgacatcaccacaagtaccacgtcctccgcct
ccccagccccagcaggctccacaaacccctcagccttcacagctgcaacgtgtcgacagc
aaacaccaaatggcaaagaagagtacgtctccgtttgtgcccggggtgggaggaacccac
gcctctaagatcatgcactcgctttcctccagtcccagtaacctcgccactgtaaaaacg
gcgaacgtcccaatcgcagccacgcccactcccgccctgctgtaccccaaacagcagcct
gcgcccaacccgcctctggttccccccgccaccaccacaatcccacatcagccagcgtac
cgcgccccaacagaccgcatcttctacctgccccacacgtgccagccggcctgcctgaag
cgcgtccgtcctgtcagacaagactttcaccgtggaaagaaccccctcctgacgccttta
ctgtacgacttcagacgcatgacaggccggcgcaaagtcaaccgcaagatgtccttccat
gtcatctataaggcgccatgtgggctttgcctgcggaacatgtcagagatccagcactac
ctcttccagacaaactgtgactttatatttttagagatgttttgtttggacccttacgtg
ctggtggatcggcccttccagcctcagaggcctttctactatattcctgacatcaccagt
ggacgagaggacatcccattgtcctgcgtgaacgagatcgattccacgccgccccctaaa
gttgcctacagtaaagaacgtattcctgaagacggggtgttcatcaacaccagcgacgac
ttcctggttggctgcgactgcacagacggctgcagagacaagtctaaatgctcttgtcac
cagctgacctgtcaggctacaggttgtaccccaggggggcagattaaccagaatgcgggg
tatttgtacaaacgattagaggagtgcctccccacagggatctacgagtgtaacaagcgg
tgcaaatgctgcccccagatgtgcaccaaccgactggtgcagcacggcctgcaagtgcgc
ctgcagctctttaaaacccagaacaaaggctggggcatccgctgtctggatgacgtagcc
aaaggctcttttgtctgcatctacgctggtaaaattttgacagacgactttgccgataaa
gaaggtctggagatgggcgacgagtactttgctaatctggatcacatagagagcgtggag
aacttcaaagagggctacgagagcgaggctcactgttcggacagcgagggaagtggggtg
gatgtgtccaaaatgaaaatccagccgtccgccttggtgtcctcgaaccctctgggccga
caaactaagaaacgtgagtgctcgtctttgaaaacagtacgggaagagaagagctcatcg
gaggacagcgacgacggcgacgacaaagactcgaaaagcgaagaagagagcgacagctcg
gacgacacgttcatcaaagacagctactacagctccagctccgtgtggaggagttacacc
acgcgtgggcaggtcaaaggtaacaaggaaggaagtcaagacagtaaagatggcctgaac
ccctccaccaaagggacggatgaggacaagccaccagcgatgccagaggagacggggaag
agtaaagtggcttcctggctcaaccaggggctgaagacggtgagcaccgatattgggacc
agatccggttatcgcgttccatcacaggacgtgatgactctctccgacagcgatgacgtt
cagaccatcagctccggctctgacgacaacaaggagaaagagaaagtcaccctgggtgtg
actaagaagcaggtggcagtgaagtccacccggggcatcgccctaaaggccggccacggg
atgatggtgaaaaccggtacgcccggcggcggcggcggaggaggaggtccagggggcggc
agcaagacagggcagcagggacactcgggcgggggcggagacaacgctcacagaaacact
cgcctgttctttgacggcgaggagtcctgttacatcattgatgctaagctggaaggaaac
ctcgggcgctacctcaaccacagctgcagtcctaacctgtttgtccagaatgtctttgtg
gacacgcatgacttgcgctttccctgggtggcgttctttgccagcaagcggattcgggcc
ggcacggagctgacgtgggactacaactacgaggtgggcagcgtggtggggaaggtgctg
ctctgctgctgcgggtccaccgagtgcaggggaagactgctgtga

DBGET integrated database retrieval system