KEGG   Takifugu rubripes (torafugu): 101075287Help
Entry
101075287         CDS       T02386                                 

Definition
microsomal glutathione S-transferase 3-like
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101075287
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101075287
   00982 Drug metabolism - cytochrome P450
    101075287
Enzymes [BR:tru01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101075287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 140 aa AA seqDB search
MGVLSVLPSDFGYVIFTYLYSWVMLAYLAIKVGLARKKYDVKYPTMYSEKDQMFNCIQRA
HQNTLELYPQWLVFQTIAALVYPLTASVLGAIWVTSRFTYAWGYYTGDPSKRLNGAYGYI
GSLGVIALSVCVALQLLGVI
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgggcgttctgagcgtgttaccgtccgattttggctacgtcatcttcacctacctgtac
agctgggtaatgctggcctatctagcgatcaaagttggtttggccagaaaaaaatacgac
gtcaagtatcccacaatgtacagtgagaaggatcagatgtttaactgcatccagagggcc
caccagaacaccctggagctgtatccccagtggctggttttccagaccatcgcagctctt
gtctacccgttaactgcatctgtgctgggggcaatttgggtgaccagtagatttacctat
gcctggggctactacactggagatccatccaaaaggctgaatggtgcctatggctacatt
ggatcccttggagttattgctctgtctgtctgcgttgccctgcagctgctgggagtcatc
taa

DBGET integrated database retrieval system