KEGG   Takifugu rubripes (torafugu): 101075300Help
Entry
101075300         CDS       T02386                                 

Definition
prolactin receptor-like
Orthology
K05081  
prolactin receptor
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    101075300
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101075300
   04060 Cytokine-cytokine receptor interaction
    101075300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 621 aa AA seqDB search
MKKAIIHLMFVLVFSLSAEGTTHSLPGKPTLIRCRSPEKETFTCWWEPGSDGGLPTTYAL
YYRKENSDTVYECPDYQTAGENSCFFNKNNTSIWVNYNITVVATNELGSTFSDSVDVDVV
YIVKPNPPEKLRVVIMEDNSYPFLRVSWEPPHKADTRSGWITLIYEIRVKLEGRNDWEVH
LAGQQKMFNIFSLRSGGTYLVQVRCKPDHGFWSEWSSPSQVQVPEYFHQEKSMWITVITF
SAIIVFIVSWLLYVNSHSLKHCILPPVPGPKIKGFDEQLLKNGKSEEVLSALMVSNFPLS
APSNYDDILVEYLEVCIPKEQGQLESKDLLDVSFKSECSTSDSDSGRGSCDSHTLLTDKC
GATKEELMDEDQRRAEMGAERQKMSWNEEMMANCHENMAGPAICNGRVKTWPSVFSSLPQ
NGTDLLEQQRSLVMARQHYPSDNLFPPGSASSYVNHPSPGALRPEFTTNEKHPCVLHPQM
LSCRKLQSHSNVDISSIGLKRAPAGLTSAALEPANNADAQRVTSELLLHADEPGDADGSA
QMGKYYSKVKGVDRGNMLLLQREETEDYSNQQRHPDGAKGGCHTYSTVTVTKDPASAIRG
QTILKTSGYVDTSTMCMLPSH
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaggccataattcatctgatgtttgtgctggtcttctccctgagtgcagaggga
acaactcacagccttccagggaagcccactctgatccgatgtcgttctcctgaaaaagag
acgttcacctgctggtgggaaccaggatcggatgggggcttgcccaccacttatgccttg
tactaccgcaaagagaactctgacaccgtgtacgagtgtcctgactatcagacggccgga
gagaactcctgcttcttcaacaagaacaacacgtccatctgggtcaactacaacatcact
gtggtggccacgaacgagctgggcagcaccttctcagactccgtggacgtggatgtagtg
tacatcgtcaagcctaaccctccagagaagctgagagtggttataatggaggacaacagc
tatcctttcctgcgggtgtcatgggaaccaccgcataaggctgacacccgctccggttgg
atcacactcatctatgagatccgtgtcaagttggagggacgaaacgactgggaggtgcat
ctcgccggtcagcagaagatgtttaacattttcagcctgcggtcaggcggcacatacctg
gttcaggtgcggtgtaaacctgatcatggcttctggagcgaatggagttctccttcccag
gttcaagtcccagagtatttccatcaggagaagtcgatgtggataacggttatcaccttt
tctgccattatcgtcttcattgtctcatggctcctatatgtgaacagccacagtctgaag
cattgcattttgccacctgttcccggccctaaaatcaaaggctttgatgaacaactgctc
aagaacggtaagtccgaggaggtcttgagcgcactgatggtgtccaatttcccactgtct
gcaccatctaactatgacgacatcctggtggaatatctggaggtgtgcatccccaaggag
caaggccaactcgaaagcaaggatttactcgacgttagcttcaaatctgagtgctccaca
tctgacagcgactctggccgaggcagctgcgacagccacactttgctgacagataagtgc
ggagcgacgaaagaagaactaatggatgaggaccaaagaagagcggagatgggtgcagag
aggcagaagatgtcctggaatgaggaaatgatggcaaattgtcatgaaaacatggccggc
cccgctatctgcaatgggagagtgaagacgtggccgtctgtgttttcctcattacctcag
aatggcacggacttgctggaacagcagagatcacttgtgatggccaggcagcactacccc
tccgacaacctgttccctccagggtctgcatcctcttacgtcaaccacccaagtcctggc
gctctccggccagagttcacaacaaacgagaagcatccctgtgttctccatccacagatg
ctgtcctgcaggaagctgcagtcccacagtaacgttgacatctccagcatcggcctcaaa
cgggcacccgctggcctgacatcagccgccttagagcccgccaataatgccgatgctcag
agggtcaccagcgagctactcctgcacgcagatgagcccggcgatgccgatggctccgca
caaatggggaagtactacagcaaagtgaaaggcgttgataggggcaacatgctgctcctt
cagagagaggaaaccgaagactacagcaaccagcagcggcatccagacggagcgaaagga
ggctgccacacatactccaccgtcaccgtgactaaagaccctgcatctgccatcaggggg
caaaccatcctaaaaaccagcggttatgttgacacgtcaaccatgtgcatgctgccctcc
cactag

DBGET integrated database retrieval system