KEGG   Takifugu rubripes (torafugu): 101075343Help
Entry
101075343         CDS       T02386                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform-like
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Inositol phosphate metabolism
Adrenergic signaling in cardiomyocytes
Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101075343
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    101075343
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101075343
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101075343
Membrane trafficking [BR:tru04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101075343
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Un
AA seq 1289 aa AA seqDB search
MEAVKVMKSCTDVIEIAKHEIQILKRLRRLDPNTSHVVRFNSFFFNMEDICLSFEFLDVD
LDTYISEMSPCKTGLPLPEVRHITEQLVTALHHLKTIGLIHMDIKPENVMIVDRHEKPLQ
VKLVDFGGAQMSGNIDFETLMFTKMYSSPEVLLESEMNEALDMWSLGVTAFKLAVGTDLF
PYSRRYKHESLSYSQTGTEFRLLHSDCGKVARPMSAMFTQSRTEKNLKFICQFHTSNWDT
LSVILPSQCSVHQLRLCISMQAQEQNCHPDPLSILDPEKYTLLYTKSEDWYEVYDDHQVI
RTLDVPWTREDTGILSAQIVVKPAAVESAERKMQEQCLNYLIGYNLDNEASDRLDELTFT
RRKLTSPRRQELKNRNDKLYTTEPWITSSPVPNDCQDQIKRNHPITLHYMDKISFSIDVN
LSACPKVLLQYFAKVMADQGLEYDTDNDLVLKVFGREEFISGDYALSSFLWLRHCLKTNQ
DIHLSVVSVSQLEEETVKFVDWPLIEDSSNQFSSHHNLCLERDHLDIVMISLWDCHRYLR
VKLLGFDIPKLPDKCPQTIYVKASVLFGSKVLSSVCSSPKAFAEEVLWNEWLEFDVLLQD
LQRGTKLGFSINEIPPVGKDMVPEQNKGKEKLLYFVNLNIIDHRSLLTQGPNTLHMWSYL
NVEEGAITYQADKLSTATNPDKAESVAITFLLDSYSFPVVLPDSLPLSNNSEHPSSATAQ
SKSRTISLSQSQSSPTIAPPVISSTFSHMNPVEAPLRNYAPPGFLSPELNLNRDCLKRFR
EESILYCSVLPHYLSTLDWMNRKIVQDVHWLLGNCNPEELDVIVALELLGIDFPDMMVRR
LAVQRLESLSNDDVLKYLLQLVQTLKVEPYHDSFLARYLVRRALRSKRVGHFFFWYTRSE
VTGCPYFRQRMAVILEAYLLGCGQAMLDSFIQQVKAVEVLHKVAKTTKSLFPDKTDLPIS
APLRLQELLRNSQLPHEFLLPFDPRVKAGRILLDKCKVMASKKKPLWLEFCPMPSPITAA
PVGIIFKEGDDLRQDMLVIQTLMVMDSIWQERSLDLNLVPYGCISTGHNIGMIEIVRNAV
TIAAIQRSVGGTTGAFRNDALYEWLRSKGPPEEIHHTTVERFVKSCAGYCVATYVLGIGD
RHNDNIMVTNDGNLFHIDFGHILGNTKHFLGMNREHVPFVLTPDFLYVMGGAKGRSSLWI
QAFRDTCTRAYLSLRSHSQLLITLFSLMLLTGIPELSTSEDMRYLRKALQEEQSETEAKE
HFLQQIAECEKMGWTVQANWWIHMLAGIK
NT seq 3870 nt NT seq  +upstreamnt  +downstreamnt
atggaggccgtgaaggtaatgaagagctgcactgatgtcattgaaattgcaaagcatgaa
atccaaatcctgaagcggctgcggcgcctggatcccaacaccagtcacgtggtcagattt
aacagctttttcttcaacatggaagacatctgtctaagctttgagttcctggacgtggac
ctagacacctacatttctgagatgagtccatgtaaaacgggtctccctctaccagaggtc
agacacattacagaacaactcgttacggctcttcaccatttaaaaaccatcgggcttata
catatggacattaaaccagaaaatgtcatgattgtggaccgccatgaaaaaccactgcaa
gtaaagttagtggactttggtggggcccagatgtccggtaatattgactttgagacctta
atgttcaccaagatgtacagctctccagaggtactcctggagtctgaaatgaatgaggct
ttggacatgtggtctttgggggttactgctttcaaactggctgtcggaactgatctgttt
ccatacagtaggcggtacaaacatgaatcactctcttacagtcagacaggtacagagttc
agactcctccactcagattgtggaaaagtagcacgtcctatgtctgccatgttcactcaa
agcaggactgagaagaacctgaagtttatctgccagtttcacactagcaactgggacaca
ttatcagtcattctgccttcacagtgcagcgtccaccaactgcggctatgcatctctatg
caggctcaagaacaaaactgccacccagacccactctcaatattggacccagagaaatac
actttactgtacaccaaaagtgaagactggtatgaagtctatgatgaccaccaggttatc
aggacattggacgttccgtggacacgtgaggacacggggattctgtcagcacaaattgtg
gtaaaaccagcggccgtagagtcggcagaaagaaagatgcaggaacagtgtctgaactac
ctgattggatacaaccttgacaatgaggcctcagacagacttgatgagctcacgttcact
cgtcgaaaattaacctctcccagaagacaagagctaaagaatcggaacgacaagttatac
accacagagccatggataacatcttcccctgttccaaatgactgccaggaccagataaaa
agaaaccacccaataactctacattacatggacaaaataagcttcagtatagacgtcaac
ctcagtgcatgtccaaaggtcctgcttcagtactttgcaaaggtcatggcagaccagggt
cttgaatatgatactgataatgatctggttttgaaagtctttgggagggaggagtttatt
tcaggagactatgctctgagcagttttctctggcttcggcattgcttgaaaaccaatcaa
gacatccacctttcagtggtgtctgtgtcacagctcgaggaggagactgtcaaatttgtg
gactggcccctcatcgaagactccagcaatcagttcagctctcatcataatctttgcctt
gagagagatcatttggatattgtcatgatatccttatgggactgccacagatatctccgg
gtcaaactgctcggctttgacatccctaaacttccagacaaatgccctcagaccatttat
gtaaaagcctcagtcctctttggtagtaaggttctctcatcagtttgttcttctcccaag
gcttttgcagaagaagttctttggaatgagtggctcgaatttgatgtcctgctacaggat
cttcaacgtggcactaaactcggcttcagtataaatgaaatccccccagtgggtaaagac
atggtgccagagcaaaataaagggaaagaaaaattgctatattttgtcaaccttaatatc
attgatcacaggtctcttctcacccagggccctaataccctgcacatgtggtcatacctt
aatgtggaagagggagcaatcacctaccaggcagacaagttgtcaacagccactaacccg
gacaaggcagaatctgtggctattaccttccttctagatagttacagctttcctgttgta
ctccctgacagccttcccctttcaaacaactctgaacacccatcctcagccactgcgcag
agcaaatctagaaccatctcattgtcacagtcacagtcttcacccactattgccccacct
gtcatcagctctaccttttctcatatgaatcctgttgaagctcctcttagaaactatgct
cctcctggattcctgtctccagaactcaacctcaacagagactgcctcaaaaggtttcgg
gaagagagtatcctctattgctcggttttaccccactacctttccactcttgattggatg
aaccgcaaaatagttcaagatgtacattggttattgggaaactgtaatcctgaggaatta
gatgttatagttgcgctggagctgcttggcattgactttcctgacatgatggtacggaga
ctagccgtccagaggttggagagcctatcaaatgatgatgtgctgaagtatttgctgcag
ctggtacagaccctaaaagtggagccctaccatgacagtttcctcgctcgttacctcgtc
cgaagagctctgaggagcaagagagttggacattttttcttctggtacactcgcagtgag
gtcacgggatgtccatactttcgacagcgcatggcagtgattctggaggcctaccttctg
ggctgtggccaggccatgcttgacagtttcatccagcaggtcaaagctgttgaggttttg
cacaaggtggctaaaacaacaaaaagtctttttccagacaagactgaccttcccatttca
gctcctctcagactgcaagaacttcttagaaacagtcaacttccacatgaattcctgttg
ccgtttgaccctcgagtcaaagctggaagaatcttgctggacaaatgcaaagtaatggct
tccaagaagaaaccattgtggctggagttctgtcctatgccctcacccatcactgctgcc
cctgttggaataatcttcaaagaaggggatgacctcagacaggacatgcttgtcatacag
acactgatggtgatggactcgatttggcaagagagatctcttgatcttaatcttgtccct
tatggctgcatctccactggacacaatataggtatgattgaaatagtgaggaatgcagta
accattgctgcaatccagaggagtgttgggggaacgacaggagccttcagaaatgatgct
ttgtacgagtggctcaggtccaaaggtccgcctgaagaaatacaccacacaactgtggag
agatttgtcaagtcctgtgctggttactgtgtggccacatatgtgctgggaataggagat
cggcataatgacaacatcatggtcacaaatgatgggaacctgttccacattgactttggg
cacatcctgggcaacacaaagcactttttgggcatgaacagagagcatgtaccgtttgtc
cttacccctgacttcctgtatgtcatgggcggagccaaaggacgcagcagcctttggatc
caggcattcagggatacttgcaccagagcatacctgtccctacgctcacactctcagctg
ctcatcactcttttctcccttatgctcttgaccggaatcccagagcttagcacctcagaa
gatatgcgctatctgcggaaagcactgcaggaggaacagagtgaaacagaagctaaagaa
cacttccttcaacaaattgctgaatgtgagaagatgggttggactgtacaggccaactgg
tggatccacatgcttgcaggcatcaagtag

DBGET integrated database retrieval system