KEGG   Takifugu rubripes (torafugu): 101075373Help
Entry
101075373         CDS       T02386                                 

Definition
cAMP-dependent protein kinase catalytic subunit PRKX-like
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Calcium signaling pathway
Oocyte meiosis
Apoptosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Melanogenesis
Brite
KEGG Orthology (KO) [BR:tru00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101075373
   04310 Wnt signaling pathway
    101075373
   04340 Hedgehog signaling pathway
    101075373
   04020 Calcium signaling pathway
    101075373
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    101075373
   04210 Apoptosis
    101075373
  Cellular commiunity
   04540 Gap junction
    101075373
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101075373
   04912 GnRH signaling pathway
    101075373
   04914 Progesterone-mediated oocyte maturation
    101075373
   04916 Melanogenesis
    101075373
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101075373
   04270 Vascular smooth muscle contraction
    101075373
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101075373
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   101075373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 343 aa AA seqDB search
METNPVKENKSSAGSSAGESSPPPNVRIYCLDDLDTIATVGTGTFGRVFLVKDKKTRTFY
ALKQMKIPDVIRLKQEQHVHNEKEVLTEVTHPFIIRLFWTHHDERFLYMLMDFVPGGELF
SYLRSRGRFSNATGLFYTSEIVCAIEYLHSKEIVYRDLKPENILLDSEGHIRLTDFGFAK
KLSDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLAGYPPFFDDNPFGIYQK
ILAGKLEFPRHLDFYVKDLIKKFLVIDRARRLGNMKNGADDVKKHRWFKTIDWDAVPLRK
LKPPIIPKVSHEGDTSNFDVYPEEDWKKAPPVSHKDLEIFENF
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggagacaaaccccgtgaaagagaataaaagcagcgccggtagttcggctggagagagc
tcaccaccgccaaacgtccggatctactgtctcgatgacctggacaccatcgctacagtc
ggaactggaacttttggccgagtctttctagttaaggacaagaagacacgcactttctat
gccctaaaacagatgaaaatccctgacgtcatccggctgaaacaggagcaacacgtccac
aatgagaaggaggtgctgacggaggttacacaccccttcattatccgactgttctggacc
caccacgatgagcgctttctgtacatgctgatggactttgttccaggcggggagctcttc
agctacttgcgtagccgtgggcgcttcagcaatgccacgggcctcttctatacctctgag
atcgtgtgcgcaatagagtacctccactccaaagaaattgtttaccgcgatctgaagcca
gagaacatcctgttagacagcgaaggacacatccgcttgaccgatttcggctttgctaag
aagctgtctgacagaacctggactttgtgtggaacacctgagtacttggcacctgaagtc
atccagagcaaaggccatggtcgagcagtggactggtgggctctgggcatcctcatcttt
gaaatgcttgctgggtacccacccttctttgatgacaatccgttcggcatctatcagaaa
atcctcgctggaaagctagaattccctcgccatctggatttctatgtcaaagacctcatc
aaaaaattcctggtcattgaccgggccaggcgtcttggcaacatgaagaacggagcggat
gatgtgaagaagcatcggtggttcaagacgatcgactgggatgcagttccacttagaaaa
ctgaagcctcccataattcctaaagtctcccatgagggcgacacctccaactttgatgtt
tacccggaggaagactggaagaaggcccctcctgtgtctcacaaggacctggagatcttt
gagaacttctga

DBGET integrated database retrieval system