KEGG   Takifugu rubripes (torafugu): 101075373Help
Entry
101075373         CDS       T02386                                 

Gene name
prkx
Definition
(RefSeq) protein kinase, X-linked
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
tru  Takifugu rubripes (torafugu)
Brite
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101075373 (prkx)
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   101075373 (prkx)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
8
AA seq 354 aa AA seqDB search
MASSKTKVGFNMETNPVKENKSSAGSSAGESSPPPNVRIYCLDDLDTIATVGTGTFGRVF
LVKDKKTRTFYALKQMKIPDVIRLKQEQHVHNEKEVLTEVTHPFIIRLFWTHHDERFLYM
LMDFVPGGELFSYLRSRGRFSNATGLFYTSEIVCAIEYLHSKEIVYRDLKPENILLDSEG
HIRLTDFGFAKKLSDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLAGYPPF
FDDNPFGIYQKILAGKLEFPRHLDFYVKDLIKKFLVIDRARRLGNMKNGADDVKKHRWFK
TIDWDAVPLRKLKPPIIPKVSHEGDTSNFDVYPEEDWKKAPPVSHKDLEIFENF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcttcctcgaaaacaaaagttggattcaacatggagacaaaccccgtgaaagagaat
aaaagcagcgccggtagttcggctggagagagctcaccaccgccaaacgtccggatctac
tgtctcgatgacctggacaccatcgctacagtcggaactggaacttttggccgagtcttt
ctagttaaggacaagaagacacgcactttctatgccctaaaacagatgaaaatccctgac
gtcatccggctgaaacaggagcaacacgtccacaatgagaaggaggtgctgacggaggtt
acacaccccttcattatccgactgttctggacccaccacgatgagcgctttctgtacatg
ctgatggactttgttccaggcggggagctcttcagctacttgcgtagccgtgggcgcttc
agcaatgccacgggcctcttctatacctctgagatcgtgtgcgcaatagagtacctccac
tccaaagaaattgtttaccgcgatctgaagccagagaacatcctgttagacagcgaagga
cacatccgcttgaccgatttcggctttgctaagaagctgtctgacagaacctggactttg
tgtggaacacctgagtacttggcacctgaagtcatccagagcaaaggccatggtcgagca
gtggactggtgggctctgggcatcctcatctttgaaatgcttgctgggtacccacccttc
tttgatgacaatccgttcggcatctatcagaaaatcctcgctggaaagctagaattccct
cgccatctggatttctatgtcaaagacctcatcaaaaaattcctggtcattgaccgggcc
aggcgtcttggcaacatgaagaacggagcggatgatgtgaagaagcatcggtggttcaag
acgatcgactgggatgcagttccacttagaaaactgaagcctcccataattcctaaagtc
tcccatgagggcgacacctccaactttgatgtttacccggaggaagactggaagaaggcc
cctcctgtgtctcacaaggacctggagatctttgagaacttctga

DBGET integrated database retrieval system