KEGG   Takifugu rubripes (torafugu): 101075384Help
Entry
101075384         CDS       T02386                                 

Definition
28S ribosomal protein S18b, mitochondrial-like
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
tru  Takifugu rubripes (torafugu)
Brite
Ribosome [BR:tru03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    101075384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 212 aa AA seqDB search
MLRLEPGQSRKIRRSPLILGSDNAASVQDEGGAAVLSPYKDRPWDYLTSEEYIERYGAMP
VWTSYRRNHKGGIPPQKTRKTCIRGDKICGNPCPICRDRNIVIHHQNVKLLQQFISPQSG
IVYDPTRTGVCMKQQKKLTEAISTARNHGLLLFHIPFVEFSGEDYSNSHDAVGLTASLQP
PASPYYSWYGEIIPDEAEVAKVKKTYKAYLKR
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgttacggctggaacccggccagtctagaaagatcagaagatctcctttaatacttggt
tctgacaacgctgcatcagtccaggatgaaggtggagctgcggttttgtcgccctataag
gacagaccctgggattacttaaccagtgaagagtacattgagagatatggagccatgcca
gtatggacaagctacaggaggaatcacaaaggaggaattcctccacagaagacacgcaag
acatgcatcagaggggacaagatatgtgggaatccctgtccaatttgtcgggatcggaac
atagttatccatcatcagaatgtgaagttgttgcaacagttcattagtccacaatctggc
atagtttatgatcccactcgaaccggtgtgtgcatgaagcagcagaagaagctaacggag
gcaatttctacagcacggaatcatggtttgctgctatttcacatcccatttgtggaattt
tctggagaggactactccaattcccatgatgcagtagggttgacagcttctctccagcct
ccagcttctccctactattcctggtatggtgaaataatccccgatgaagcggaagtggcc
aaagtaaagaagacatataaagcttacttaaagagatga

DBGET integrated database retrieval system