KEGG   Takifugu rubripes (torafugu): 101075416Help
Entry
101075416         CDS       T02386                                 

Definition
GTP cyclohydrolase 1-like
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101075416
Enzymes [BR:tru01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     101075416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 230 aa AA seqDB search
MNALSSKSGAAADFLCNSHGFSELLIDANKQREHETSRKEAEDKSRLPALEAAYTCILRE
LGEDMDRQGLLRTPLRAAKAMQFLTKGYHETVDDILNNALFDEDHDEMVIVKDIDMFSLC
EHHLVPFFGKVHIGYIPNKKVVGLSKLARIVEIYSRRLQVQERLTKQVALGISEALQPKG
VAVVIEAVHMCMIMRGVQKMNSRTVTSTMLGVYLEDPKTREEFLMLSQSN
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgctgagcagcaagagcggcgcggccgcggacttcctgtgcaacagccacggc
ttcagcgagctcctcatcgacgccaacaagcagcgcgagcacgagacgtcccgcaaagag
gcggaggacaagtcccgcttacctgcgctcgaggccgcctacacctgcatcctgcgcgag
ctgggcgaggacatggaccgccaggggctgctgcgcacgccgctgcgcgcggccaaggcc
atgcagttcctgaccaagggctaccacgagacggtggacgacatcttaaacaacgctcta
tttgatgaggaccacgatgagatggtgattgtgaaggacatcgacatgttctctctgtgt
gagcatcacctggtgcccttttttggaaaggttcatatcggttatatccccaacaaaaaa
gtggtgggactcagcaaactggcgaggattgtggagatctacagtcggaggcttcaggtt
caggagcgtctcaccaagcaggttgctctgggaatatcagaggctctgcagcccaaaggc
gtcgctgtggtgattgaagcagtgcacatgtgcatgatcatgcgtggcgtccagaagatg
aacagccgcacggtgaccagcaccatgctgggggtttacctggaggaccccaagacccgg
gaggagttcttgatgctgtcacagagcaactaa

DBGET integrated database retrieval system