KEGG   Takifugu rubripes (torafugu): 101075569Help
Entry
101075569         CDS       T02386                                 

Definition
cGMP-dependent protein kinase 1-like
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Gap junction
Brite
KEGG Orthology (KO) [BR:tru00001]
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    101075569
Enzymes [BR:tru01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     101075569
Protein kinases [BR:tru01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   101075569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 689 aa AA seqDB search
MGTLRDLQYALQLKIEELRQRDTLIDELELELDQKDELIQRLQNELDKYRSVLRPATAQQ
VQAQQQSLVLQPDQHRSKRQAISAEPTACDISDLSHVTLPFYPKSPQSKEMIREAILDND
FMKNLELSQIHEIVDCMYPVEYGKDACIIEEGDVGSLVYVMEEGKVEVTKEGMKLCTMGP
GKVFGELAILYNCTRTATVRTLVHVKLWAIDRQCYQTIMMRTGLIKHAEYMDFLKSVPTF
KGLPEETLSKLADVMEETHYEDGDYIIRQGARGDTFFIISNGKVNVTQEDPDNQGPVHLR
ELTRGDWFGERALQGEDVRTANVMAADAVTCLVIDRDSFKHLIGGLEEVSNRGYEDVEAK
AKYEAENAFFSGLKLNDFNIVDTLGVGGFGRVELVQLKKEEAKTFAMKILKKRYIVDTRQ
QEHIRSEKQIMSEAHCDFIVRLYRTFKDRKYLYMLLEACLGGELWTLLRDRGSFDDTTTR
FYTGCVVEAFAYLHAKGIIYRDLKPENLLLDSHGYAKLVDFGFAKKIGLCKKTWTFCGTP
EYVAPEIILNKGHDVSADYWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMVEFPKK
VTKNATNLIKKLCRDNPSERLGNQKSGVKDIQKHKWFEGFNWEGLRKGTLTPPIRPDVSS
PTDTSNFDSFPEDTDEPPPDDNSGWDYDF
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggggaccctgcgggacttgcagtatgctctgcagctgaagatcgaggagctccggcag
cgagacaccctgatcgatgagctggagctggagctggatcagaaagatgagctgatccag
cgactccagaatgaactggataaataccggtccgtgctccgacccgccaccgcccagcag
gtccaggcccagcagcagagcttggtcctccagccggaccagcaccgcagcaagcgccag
gccatctcagcggagcccactgcctgtgacatcagcgacctcagccacgtcacgttgccg
ttttaccccaagagcccacagtccaaggagatgatccgggaggccatcctggacaatgac
ttcatgaagaacctcgaactgtcccagatccatgagatcgtggactgcatgtaccccgtg
gagtacggcaaagacgcctgcatcatcgaggaaggggacgtgggctcgctggtctacgtc
atggaagaggggaaggtggaggtcaccaaggaggggatgaagctgtgcacgatgggaccg
ggaaaagtgtttggggagctggccattctgtacaactgcaccaggacggcaaccgtcagg
acactggtccatgtgaaactgtgggctatcgaccgtcagtgctaccaaaccatcatgatg
agaaccggactcatcaaacacgccgagtatatggacttcctcaagagtgttcctactttc
aagggtcttccagaggaaaccctcagtaaactggctgatgtcatggaggagactcactat
gaggatggcgactacatcatcagacagggagcgcgaggagacacgttcttcatcatcagc
aacggcaaggtgaatgtgacccaagaggatccagacaatcaggggccagtgcacctaaga
gaactgaccaggggcgactggtttggagagagagccttacagggggaggacgtgagaaca
gctaacgtcatggcggcggacgctgtcacctgtctggtcattgacagagactcattcaag
catctgattggtggactggaggaagtctcaaacagaggatacgaggacgttgaagcgaaa
gccaagtacgaggctgagaacgcctttttctccggtctgaagctgaatgacttcaacatc
gtcgacacgctgggagttggcggctttggaagagtcgagctggtgcagctgaagaaggag
gaggcaaagacatttgccatgaagatcctgaagaagcgttacatcgttgacacgagacag
caggagcacatccgctcggagaagcagatcatgagcgaggcgcactgcgacttcatcgtc
aggttgtaccggacgtttaaggatcgtaaatacctgtacatgcttctggaagcatgtctt
ggaggagagctgtggacactattgagagacaggggttccttcgatgatacgaccactcgt
ttttacacgggctgtgtggtcgaagccttcgcctacctgcacgccaaaggcatcatatac
agagacctgaagcctgagaacctcctactggacagccacggatatgccaaactggtggat
tttgggttcgccaagaagatcggcctctgcaagaagacatggaccttctgtggaacccca
gagtatgtcgctccagagatcatcctcaacaaaggtcacgatgtgtcggcggactactgg
tctctgggaatcctgatgtacgagctgctgacaggcagcccccctttctcaggtccagat
cccatgaagacctacaacatcatcctgagaggcatcgacatggtggagttccctaagaag
gtgactaagaatgccaccaacctcatcaagaagctctgcagagataatccgtcggagcga
ctggggaaccagaagagcggtgttaaagacatccagaaacacaagtggtttgaagggttt
aactgggagggtctgaggaaagggactctgactccgcccatcaggcctgacgtttcctct
cccaccgacaccagtaactttgacagtttccctgaagacacggatgagcctcctccggat
gacaactctgggtgggattatgacttctag

DBGET integrated database retrieval system