KEGG   Takifugu rubripes (torafugu): 101075779Help
Entry
101075779         CDS       T02386                                 

Definition
TNF receptor-associated factor 2-like
Orthology
K03173  
TNF receptor-associated factor 2
Organism
tru  Takifugu rubripes (torafugu)
Pathway
MAPK signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
RIG-I-like receptor signaling pathway
Adipocytokine signaling pathway
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101075779
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    101075779
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    101075779
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    101075779
  Endocrine system
   04920 Adipocytokine signaling pathway
    101075779
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101075779
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 568 aa AA seqDB search
MASQEPSPPSSLEGNKPGFPKKILANNLENKHLCKSCQKVLRRPLQAQCGHRFCSFCFHK
IVSAGPQTCSACISEDLFEEPASILKLGGAFPDNAARREVEALAAVCPNEGCIWTGTIKE
FEARHEDSCDFMIILCPSCKELMRVNEQERHNERECPERTLNCKYCKDPFQLKNIKAHDE
ICPKYPMICEGCSKKKIPREKYVDHIKYCSKFKSPCRFHVVGCNTSVEKEKIHDHERQCS
YEHLNLLLHFIMGIKISLESLPPQSLDVASHKLLELHQSLRDLELKMSQISGSGLTIAQG
VCAPSVATSFTPLPSSVRAALELQLQSEKTKVAELSRRCQDLELKVRTFENIVCVLNREV
ERSCTTMEAYNRQHRLDQDKIEILNNKVRQLERTVSLRDLSIVEIDEKMRELSAATYDGV
FVWKISDFTKKRQDAVAGRAPAMFSSAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVV
MRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFRPDISSSSFQRPVSDMNIASGCPLFC
PLPKLDCKNSYIRDDTIFIKVIVDLTGL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atggcttcacaggagccgtctccaccgtcttccctcgagggcaacaaaccaggattcccg
aagaaaattctggcaaacaacctggaaaacaaacacttgtgtaaatcgtgccagaaggtc
ctcagaaggccgttacaagctcagtgtggacaccgtttctgctccttctgttttcacaaa
atagtgagtgcgggaccacagacatgcagtgcatgtataagtgaagatctgtttgaggaa
cctgcctctattctcaagttaggtggtgctttccctgacaatgcagcccggagggaagtg
gaggccttggctgctgtctgtcccaatgaaggatgcatatggacaggaactatcaaagaa
tttgaggctaggcatgaggacagctgtgacttcatgattatcttgtgtccttcctgtaaa
gagcttatgagagtcaatgaacaggagcgtcacaatgaaagagaatgtccagagcggact
ctcaactgcaagtactgcaaagaccccttccagttaaagaacatcaaggctcatgatgaa
atttgtccaaagtatccaatgatatgtgaaggttgttcaaagaaaaagatcccaagggaa
aagtatgtggatcatattaagtactgcagtaaatttaaatcaccgtgcagatttcatgtt
gttggctgcaacacatcagttgaaaaagagaaaatccatgaccatgagcgacagtgttcc
tatgagcatttaaatcttctgctgcatttcatcatgggcatcaagatcagcctggagagc
ttgccgcctcagagtctggatgtggccagtcacaagttgttggagcttcatcagtccctc
agggatcttgaacttaagatgagccagatcagcggtagtggtctgaccattgcacagggt
gtttgcgccccatctgtagcgacctctttcacaccattacctagtagcgtaagagctgct
ctggagttacagttacaaagcgagaagactaaggtggctgagctgagccggcgctgccag
gacctcgagttaaaagtgagaactttcgaaaacatcgtgtgtgtcctcaacagggaggtg
gagcgctcatgcaccaccatggaagcatacaaccgccagcatcgactggaccaggacaag
attgaaatcctaaacaacaaggtccgtcagcttgagaggactgtgagtctgagagactta
tccatcgtggagattgatgagaaaatgagggagttgtctgctgccacatatgatggtgtt
tttgtctggaagatttcagatttcactaagaagaggcaagatgctgtggctggtcgtgct
cctgccatgttttcatccgcattttatacaagtaaatatggctataagatgtgcctgcgg
atctacctgaatggtgatggcacaggccgtgggacccacttatctctattttttgtggtc
atgagaggccacagcgacgccctccttaaatggcctttcaaccaaaaggtcaccctaatg
ctgcttgaccagaacaacagggagcacataatcgatgctttccggcccgacatctcctcc
tcgtcctttcagaggccagtcagtgacatgaatattgccagcggttgccccctcttctgt
cctctccctaagctggactgtaaaaactcctacatacgtgatgacaccatcttcatcaag
gtcatcgtggatctcactggcctctag

  All links  
No link information was found.   
DBGET integrated database retrieval system