KEGG   Takifugu rubripes (torafugu): 101075956Help
Entry
101075956         CDS       T02386                                 

Gene name
capn11
Definition
(RefSeq) calpain 11
  KO
K01367  calpain-1 [EC:3.4.22.52]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
tru04141  Protein processing in endoplasmic reticulum
tru04210  Apoptosis
tru04217  Necroptosis
tru04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101075956 (capn11)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    101075956 (capn11)
   04217 Necroptosis
    101075956 (capn11)
   04218 Cellular senescence
    101075956 (capn11)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     101075956 (capn11)
Peptidases [BR:tru01002]
 Cysteine Peptidases
  Family C2: calpain family
   101075956 (capn11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_6 EF-hand_8 EF-hand_1
Motif
Other DBs
NCBI-GeneID: 101075956
NCBI-ProteinID: XP_003964156
Position
4
AA seq 704 aa AA seqDB search
MYSVGGISASIYANRLRAEGMGSNDRAVPFWNQDYEALKQQCVESGCLFEDPCFPAEPPS
LGFKELAPHSSKTQGVEWQRPTELTDDPQFIVGGATRTDICQGALGDCWLLAGIASLNLN
ERLLHRVVPHGQSFQDDYAGIFHFQFWQFGEWVDVVIDDRLPVKDGEVMFVHSAEGNEFW
SALLEKAYAKLNGSYEALSGGSTTEGFEDFTGGVSEMYELRSAPRDLPKIISKALDRGSL
LGCSIDITSAFDMEAVTFKKLVKGHAYSVTGLKEVNFRGRMERLIRVRNPWGQVEWTGAW
SDNSSEWNEIDPSEREDLHLKMEDGEFWMSFNEFKKQFSRIEICNLTPDALSEDALSHWN
TMTYSGMWRRGSTAGGCRNHPNTFWINPQFKITLLEEDDDPEDDEVACTFLVALMQKDRR
RYRRQGQDMHTIGFAVYEIPEEFKGCQNVHLKKNFFLNHSSCARSETFINLREVSTRLRL
PPGEYLIVPSTFEPHKEADFVLRVFTEKQSETEEMDDQISADLGDEDEISEEDIDDSFKS
MFAQLAGEDMEISVHELKTILNRVVTRHKDLKTDGFSTVSCRTMVNLMDKDGTAHLGLVE
FQILWNKIRKWLVIFRQFDLDKSGAMSSYEMRLAVEAAGFKLNNKLNQILVARYAENDMI
NFDNFICCLVKLEAMFRHFQQLDKEGSGVAEINITEWLYVTMCG
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtattcagttggagggatctctgcaagcatatatgccaacaggctgcgagcggagggc
atgggctccaacgatcgtgcggtgccgttctggaaccaggactacgaggcactgaagcag
cagtgtgtggagtcagggtgcctgttcgaagacccctgtttccctgccgaacctccatcc
ctgggctttaaggagctggccccgcactcctcaaagacccagggggtggagtggcagagg
cccacggaattgacagatgatcctcagtttattgtgggcggagccacaagaacagacata
tgtcagggagccctgggtgactgctggctcttagcgggcatcgcgtctctcaacctgaat
gaaaggcttctgcaccgggttgtcccgcatggacagtccttccaggatgactatgctggc
atcttccactttcagttctggcagtttggcgaatgggtggacgttgtcatcgacgacaga
ctacctgtcaaagacggcgaggtgatgttcgtccactcggctgaggggaatgaattctgg
agtgcacttctggagaaagcttacgccaagctgaacgggtcgtacgaggccctgtctgga
ggaagcaccacggaagggttcgaggacttcacgggcggcgtctccgagatgtacgagctg
cgcagcgcccccagagatctgcccaaaattattagcaaagccctggacaggggctctctg
ctgggctgctccatcgatatcacaagtgcctttgatatggaggctgttactttcaagaag
cttgtaaagggccacgcctactcagtcactggcctgaaggaggttaacttccggggcaga
atggagcgcctgatccgtgtacgtaacccctggggccaggtggagtggaccggggcctgg
agtgacaactcctctgagtggaatgagatcgatccttctgaaagggaagatttgcatcta
aaaatggaagatggagaattttggatgtccttcaatgagttcaagaagcagttttctcgc
atagaaatctgtaatttgactcctgacgccctgagtgaggacgccctcagccattggaac
acaatgacctactccggcatgtggaggagggggagcacggcaggaggctgcaggaaccat
cccaacacattttggattaacccccaatttaagatcacgctcctggaagaggatgacgat
ccggaggatgacgaggtggcgtgcactttcttagtggctctcatgcagaaggaccgccgc
agatatcggcgtcagggtcaggacatgcacaccatcggcttcgccgtgtacgaaattcca
gaggagttcaaaggctgccaaaatgtccacttgaagaagaacttctttttgaatcactcg
tcatgtgcacgctcggaaacgttcatcaacctgcgagaggtgagcacacgtctccgcctg
ccccccggagagtacctgatcgtcccctccacctttgagccccacaaagaggccgacttt
gtcctcagggtcttcacggagaaacagtccgagacagaagaaatggacgatcagatctct
gctgatttaggagatgaagatgaaataagtgaagaagacatcgacgactcctttaagtcc
atgtttgctcagctggcaggggaggacatggagatttcagttcacgaactaaagaccatt
ctaaacagagttgtgacccggcataaagatctgaagactgatggcttcagtacagtgtct
tgcagaaccatggtcaatctcatggataaagatggcactgcccatctgggactggtcgag
tttcaaatcctctggaataagatccgaaaatggctggtcatttttagacagtttgacctg
gacaaatcaggggcgatgagctcatacgagatgcgtctggctgtggaggcagcaggcttt
aagctgaacaacaaactgaaccagattctggtagctcggtacgcagagaacgacatgata
aactttgacaacttcatctgctgcttggtcaagctggaggccatgtttaggcatttccag
cagcttgataaagagggttcaggagtggctgagattaatatcacagagtggctttacgtg
acaatgtgtggttga

DBGET integrated database retrieval system