KEGG   Takifugu rubripes (torafugu): 101075956Help
Entry
101075956         CDS       T02386                                 

Definition
calpain-1 catalytic subunit-like
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:tru04141]
Cellular Processes; Cell growth and death; Apoptosis [PATH:tru04210]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 704 aa AA seqDB search
MYSVGGISASIYANRLRAEGMGSNDRAVPFWNQDYEALKQQCVESGCLFEDPCFPAEPPS
LGFKELAPHSSKTQGVEWQRPTELTDDPQFIVGGATRTDICQGALGDCWLLAGIASLNLN
ERLLHRVVPHGQSFQDDYAGIFHFQFWQFGEWVDVVIDDRLPVKDGEVMFVHSAEGNEFW
SALLEKAYAKLNGSYEALSGGSTTEGFEDFTGGVSEMYELRSAPRDLPKIISKALDRGSL
LGCSIDITSAFDMEAVTFKKLVKGHAYSVTGLKEVNFRGRMERLIRVRNPWGQVEWTGAW
SDNSSEWNEIDPSEREDLHLKMEDGEFWMSFNEFKKQFSRIEICNLTPDALSEDALSHWN
TMTYSGMWRRGSTAGGCRNHPNTFWINPQFKITLLEEDDDPEDDEVACTFLVALMQKDRR
RYRRQGQDMHTIGFAVYEIPEEFKGCQNVHLKKNFFLNHSSCARSETFINLREVSTRLRL
PPGEYLIVPSTFEPHKEADFVLRVFTEKQSETEEMDDQISADLGDEDEISEEDIDDSFKS
MFAQLAGEDMEISVHELKTILNRVVTRHKDLKTDGFSTVSCRTMVNLMDKDGTAHLGLVE
FQILWNKIRKWLVIFRQFDLDKSGAMSSYEMRLAVEAAGFKLNNKLNQILVARYAENDMI
NFDNFICCLVKLEAMFRHFQQLDKEGSGVAEINITEWLYVTMCG
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgtattcagttggagggatctctgcaagcatatatgccaacaggctgcgagcggagggc
atgggctccaacgatcgtgcggtgccgttctggaaccaggactacgaggcactgaagcag
cagtgtgtggagtcagggtgcctgttcgaagacccctgtttccctgccgaacctccatcc
ctgggctttaaggagctggccccgcactcctcaaagacccagggggtggagtggcagagg
cccacggaattgacagatgatcctcagtttattgtgggcggagccacaagaacagacata
tgtcagggagccctgggtgactgctggctcttagcgggcatcgcgtctctcaacctgaat
gaaaggcttctgcaccgggttgtcccgcatggacagtccttccaggatgactatgctggc
atcttccactttcagttctggcagtttggcgaatgggtggacgttgtcatcgacgacaga
ctacctgtcaaagacggcgaggtgatgttcgtccactcggctgaggggaatgaattctgg
agtgcacttctggagaaagcttacgccaagctgaacgggtcgtacgaggccctgtctgga
ggaagcaccacggaagggttcgaggacttcacgggcggcgtctccgagatgtacgagctg
cgcagcgcccccagagatctgcccaaaattattagcaaagccctggacaggggctctctg
ctgggctgctccatcgatatcacaagtgcctttgatatggaggctgttactttcaagaag
cttgtaaagggccacgcctactcagtcactggcctgaaggaggttaacttccggggcaga
atggagcgcctgatccgtgtacgtaacccctggggccaggtggagtggaccggggcctgg
agtgacaactcctctgagtggaatgagatcgatccttctgaaagggaagatttgcatcta
aaaatggaagatggagaattttggatgtccttcaatgagttcaagaagcagttttctcgc
atagaaatctgtaatttgactcctgacgccctgagtgaggacgccctcagccattggaac
acaatgacctactccggcatgtggaggagggggagcacggcaggaggctgcaggaaccat
cccaacacattttggattaacccccaatttaagatcacgctcctggaagaggatgacgat
ccggaggatgacgaggtggcgtgcactttcttagtggctctcatgcagaaggaccgccgc
agatatcggcgtcagggtcaggacatgcacaccatcggcttcgccgtgtacgaaattcca
gaggagttcaaaggctgccaaaatgtccacttgaagaagaacttctttttgaatcactcg
tcatgtgcacgctcggaaacgttcatcaacctgcgagaggtgagcacacgtctccgcctg
ccccccggagagtacctgatcgtcccctccacctttgagccccacaaagaggccgacttt
gtcctcagggtcttcacggagaaacagtccgagacagaagaaatggacgatcagatctct
gctgatttaggagatgaagatgaaataagtgaagaagacatcgacgactcctttaagtcc
atgtttgctcagctggcaggggaggacatggagatttcagttcacgaactaaagaccatt
ctaaacagagttgtgacccggcataaagatctgaagactgatggcttcagtacagtgtct
tgcagaaccatggtcaatctcatggataaagatggcactgcccatctgggactggtcgag
tttcaaatcctctggaataagatccgaaaatggctggtcatttttagacagtttgacctg
gacaaatcaggggcgatgagctcatacgagatgcgtctggctgtggaggcagcaggcttt
aagctgaacaacaaactgaaccagattctggtagctcggtacgcagagaacgacatgata
aactttgacaacttcatctgctgcttggtcaagctggaggccatgtttaggcatttccag
cagcttgataaagagggttcaggagtggctgagattaatatcacagagtggctttacgtg
acaatgtgtggttga

DBGET integrated database retrieval system