KEGG   Takifugu rubripes (torafugu): 101075998Help
Entry
101075998         CDS       T02386                                 

Definition
cell division cycle protein 27 homolog
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:tru00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101075998
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101075998
   04114 Oocyte meiosis
    101075998
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101075998
Protein phosphatases and associated proteins [BR:tru01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     101075998
Ubiquitin system [BR:tru04121]
 Ubiquitin ligases (E3)
  multi subunit Ring-finger type E3
   APC/C
    other subunits
     101075998
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 796 aa AA seqDB search
MTVLQEPVQAAVWQALNHYAYLDAVFLAERLYAEVRSEEALYLLATCYYRSGKPYKAYRL
LKAHSCSSPQVRFLLAKCCVELSKLAEGEQVLIGGVLNKQKSQDDIITEFGESASFTLSL
LGHIYCKTDRVAKGSECFQRSLTLNPFLWSPFQNLCHLGEKPDPEQVFRLSSIQNTSMVP
PPPPVSPAQNTSHRLDTVLMETPQDTLELNRLNLESSNGKLSSDLSVSYIDSSLISPETG
SLLSNTVSMASAASLIAKQNKPKSGRSLLGGPAALSPLTPSFGILPLEPSPGDPTYLQNY
SSTMETQSTAPSKKAVSRISQSKSVFSQSGNSRDVLPVPFNQTQTTAPHTSSSPQVLSPS
MSGPPNVQPRRSSRLFTSASSTAKENSKKLKMKFPTKIPNRKTKCKSAKTSNSNNLNESL
DILRLDPSLKLGRGYLALCSYNCREAINILTSLPPQHYNTGWVLTHIGRAYFELAEYTQA
ERLFSEVRRIESYRVEGMEIYSTTLWHLQKDVALSALSKDLTDMDKNCPEAWCVAGNCFS
LQREHDIAIKFFQRAIQVDPGFAYAYTLLGHEFVLTEELDRALACFRNAIRVNSRHYNAW
YGLGMIYYKQEKFNLAEMHFKKALSINPQSSVLLCHIGVVQHALKKSDAALETLNRAIGI
DPKNPLCKFHRASILFANDKYKAALQELEELKQIVPKESLVYFLIGKVYKKLGQTHLALM
NFSWAMDLDPKGANNQIKEAIDKRYLPEDEALKLGFSFSICLFLWSAAEVDDSQDSSIMT
DADDTQLHTAESDDVL
NT seq 2391 nt NT seq  +upstreamnt  +downstreamnt
atgacggtgctgcaggaacctgtccaggctgcagtgtggcaagctctgaaccactatgcc
tacctggatgcagttttcctggcagagagactttatgccgaagtgaggtcagaagaggcg
ctctacctgttagcaacatgttactaccgctctgggaaaccctataaagcttaccggctg
ctgaaggcccacagctgctcctcgccacaggttcgcttcctgttagccaaatgctgcgtg
gaattaagcaaactggctgaaggagagcaggttttgattggtggagtgctgaacaagcaa
aagagccaggatgacatcatcacagagtttggagagtcggcctccttcacgctgtcattg
ctgggccatatctactgtaagacagaccgcgttgctaaaggctcagagtgtttccaaagg
agtttaactctcaacccctttctctggtcacctttccagaacctttgtcacttaggagaa
aagccagatccagagcaggtgttcagattgtcatctatacagaacacttcaatggttcca
ccccctccacctgtcagtcctgctcagaacacctcccaccgtctggacacagtcctcatg
gaaacaccgcaggacacactggagttgaaccgtttgaatttagaatcttcaaacgggaaa
ctctcatcagatttgtcagtttcctacattgactcctccctcatctcacctgagactggc
tccttactgagcaacacggtctccatggcctcggctgcctcccttatagccaaacagaat
aagccaaaaagtggacgcagtttacttggaggacctgctgctctcagcccgttaactccc
agttttggcatcctgcccctggagcccagccccggagaccccacatatttgcagaactat
tcatctaccatggaaacacaatctacagcccccagcaagaaggccgtctccaggatcagt
cagtccaaatccgtcttcagtcagagtggtaacagcagagatgttctccccgtccctttc
aaccaaacacagaccacagcccctcacaccagtagttcccctcaggtccttagtcccagt
atgtctggtcctccaaatgtccaacccagaagaagctctagattatttacaagtgcaagt
tctacagccaaggagaacagtaagaagttaaaaatgaagtttccaactaagatcccaaat
agaaaaactaaatgtaaatcggcaaaaacatcaaatagcaacaacctgaatgaaagtctg
gacatccttcgactggatcccagtttgaaactggggcgtggctacctggcgctctgctcg
tacaactgcagagaagctatcaacatcctgacttcgctgccacctcagcactacaacact
ggctgggtcctcacacacattggcagagcttactttgaactggctgaatacacacaggca
gagcgtctgttcagtgaggttcgcaggatcgagtcgtacagagttgaaggaatggagatt
tattcaaccactctgtggcacctgcagaaggatgttgccctgtctgctctgtccaaagac
ctgaccgacatggacaagaactgtcctgaggcttggtgtgtcgcaggaaactgtttcagc
cttcagagggagcatgatattgccatcaagttcttccagagagcaatccaggtggaccca
ggctttgcttatgcttacactctgctgggtcacgagtttgttctgacagaggagttggac
agagcacttgcctgctttcgaaacgccatcagagtaaacagcagacactataatgcctgg
tatggtctagggatgatttactacaaacaggagaagttcaacttggcagagatgcacttt
aaaaaagctctaagtattaaccctcagagttcggtgcttctttgtcacatcggagtggtc
cagcatgccttgaagaagtctgatgcagctttggagaccctaaacagggcaataggaatt
gacccaaaaaacccactctgcaagtttcatcgagcatctatactctttgccaatgacaaa
tacaaggcagctcttcaagagttggaagagctgaagcagattgttcccaaagagtctttg
gtttacttccttataggaaaggtatataagaagttgggccagactcatttggctttgatg
aacttcagctgggcgatggatctggatccgaaaggagcaaataaccagatcaaagaagcc
attgataagagatacttgccagaagatgaagcattaaagttgggtttttctttctccatc
tgtctatttctttggtcagcggctgaggtggacgacagccaggacagcagtatcatgaca
gatgctgatgacacgcagctccacacagctgagagtgatgatgttctttag

DBGET integrated database retrieval system