KEGG   Takifugu rubripes (torafugu): 101076025Help
Entry
101076025         CDS       T02386                                 

Gene name
plcb2
Definition
(RefSeq) phospholipase C, beta 2
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
tru  Takifugu rubripes (torafugu)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Gap junction
GnRH signaling pathway
Melanogenesis
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:tru00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101076025 (plcb2)
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101076025 (plcb2)
   04020 Calcium signaling pathway
    101076025 (plcb2)
   04070 Phosphatidylinositol signaling system
    101076025 (plcb2)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    101076025 (plcb2)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    101076025 (plcb2)
   04916 Melanogenesis
    101076025 (plcb2)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101076025 (plcb2)
   04270 Vascular smooth muscle contraction
    101076025 (plcb2)
Enzymes [BR:tru01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101076025 (plcb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 1199 aa AA seqDB search
MNQKRHFLEPPEVKDYMVKGERFTKWSEDSTKTAPVTMKMDPKGFYLYWINQSKETTFLD
VATIRDTRTGKYAKLPKHPKVRNVFNLDFPDSNHLAKTLTVVSGPDTVNLTYHNFFASKE
KVTQNWANDIIALAYNAARNNACKQVFLEKIYVRVSLHTNKDGKIPVKNIYKMFPADKKR
VESALASAHLPKGKYDTMKPDVFTEAAFKVFLANLCPRPEILEIFTSYSNKPTMTKENFT
KFLNEKQRDSRLNEELFPRLRQDQVKALIDKYEPCSSNSNRSLISPEGLLNFLTGPETSV
VILDRLAKWQDMTQPLPHYFVKSSHNTYLTAGQFSGVSSPEMYRQCLLAGCRCLELDCWK
GKPPDEEPIITHGFTMTTEILFKDVIEAIAESAFKTSQYPVILSFENHVDTVKQQEKMAN
YCKTIFGEALLTEPLDKYPLKPGCQIPSPSELMGKILIKNKKSSNETQTHTKKTQDAAST
ATSTQENQASSEGGAAAEDTEEQEDTEEQDEEKMKTSDEGTAGQEVTAFEAMSSLVNYIQ
PNKFISFDNARKKNKSYVISSFVETKGESMIAKNAVEFVEYNKRQMSRIYPKGTRVDSSN
YSPQPFWNVGCQMVALNYQTMDFPMQLNMALFEFNGRTGYLLKHDVLRRSDKTFNPFCDR
IDTVVASTLTIKIYSGQFLSDKNVKTGIEVEVIGLPGDPKKKFRTKWSPTPNSINPVWNE
EPFVFEKILLPEMASLRIVAHEENGKFLGHRIIPLDAIQSGFHHICLHSESNMPLTLPSV
FVYIEVKDYIPAAFADFTDALFNPTKGNEKTSKTPKESSSDYISPYELPLMTQTSANDAK
EAESPAAEKAAAPTPPADVGEESTEPRPETSTADPAENVPEAEATCSEPAADAAAEEASP
DPGPVTAEPPPEAGPPADAAAEQEEVPEPEVSNEDTTSDPDTNTEPSPGDNAAAGAANEA
ANEAANEAANEAAAVAGAAGGAAQSAGGEGSAPAQMCGEEHATVTAEELTQHKNYLKAIK
RQERDMKAAEKKYQKKSEDLIQKYSDTFKAIKKKISLKKTEGGENSTDSGVKSERVQDHK
EKMLAELQLQWKEQCDHLRKKKEQFATERLAVLLEMATERHNSELKMLESEPKDNKKKTK
CSDKAKLKRAMSTELLDGPCLMACSLEEEGLSGALVTMEGSTGRSTQGQMIDMYKDCDQ
NT seq 3600 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagaagaggcactttttagagcctccggaggtcaaggactacatggtcaaagga
gagcgattcaccaaatggtcagaggactccacaaagactgctcctgtcaccatgaagatg
gacccgaaaggattctacctctactggatcaaccaaagcaaggagacaacgttcctggat
gttgctactatcagagataccagaacaggaaaatatgccaaacttccaaaacaccctaaa
gttcgcaacgtgtttaacctggacttccctgacagcaaccatctcgccaagactctgact
gtcgtctcgggaccagacacggtcaatttgacctatcacaacttctttgcctctaaggag
aaggtgacacagaactgggccaatgacatcattgcacttgcgtataacgctgccaggaac
aacgcatgcaaacaagtcttcctggagaaaatatacgttcgcgtttccctccacaccaac
aaggacggcaagatcccggtgaaaaacatctacaagatgttcccggcagataagaaaaga
gttgaaagtgcgttggcatcggcccacctccccaaaggaaagtacgacaccatgaagcct
gatgtcttcactgaggctgccttcaaggtctttctggccaacctctgccctcgtcctgag
atcctagagatcttcacctcttattccaacaaaccgaccatgacgaaggaaaacttcact
aaattcctcaacgagaagcagagggactcccggctcaacgaggagctcttcccgcgcctg
cggcaggaccaggtcaaggccctgatcgacaaatacgagccctgctcctccaactcgaac
agaagtctcatttctcctgaaggcctcttaaatttcctgactggtccagagacatccgtg
gtgattctggaccggctggccaagtggcaggacatgacccaaccgttaccccactacttc
gtcaagtcctcccacaacacatacctgacagctggtcagttctccggcgtgtcctcgccc
gagatgtaccgacagtgtctgttggccggctgccgctgcctggagctggactgctggaag
ggcaaacccccagatgaagagcccatcattacccacggcttcaccatgacgactgagatc
ctcttcaaggacgtaatcgaggctatcgctgagagcgctttcaagacctcccagtatcct
gtcatcctctcgttcgagaaccatgttgacacagtgaaacagcaggagaaaatggcaaac
tactgcaaaaccatatttggtgaggccctgctaacagagccgctggacaaataccccctg
aagccgggctgccagatccccagtccatctgagctgatgggcaagatcctcatcaagaac
aagaagagcagcaatgaaacccagacacatactaaaaaaacccaggatgctgccagcaca
gctaccagcacgcaggagaaccaggctagttcagaggggggcgctgctgcggaggacacc
gaggagcaggaggacacggaggagcaggatgaggagaaaatgaagacgtcagatgagggc
acagctggacaggaagtgacagctttcgaagcgatgtcgtccctggtcaactacatccag
cccaacaaattcatctcttttgacaacgccagaaagaaaaacaagagttatgtcatctca
tctttcgtggagacaaaaggggagtcaatgattgccaagaatgctgttgaatttgttgaa
tataataaaaggcagatgagcaggatttaccctaaaggaacaagagtggattcgtctaat
tacagcccacagcctttctggaacgtcggctgccagatggtggcgctcaactaccagacc
atggatttccccatgcagctgaacatggctctgtttgagttcaacggcagaaccggttac
ctgctcaagcatgacgtgttgcgtcgcagtgacaagacgtttaaccctttctgcgacagg
atagacacagttgtggcaagcacgctcaccataaagatttattcaggccagtttttgtct
gacaaaaatgtgaaaaccggcatcgaggtggaggtgattgggctgccgggggaccccaag
aagaaatttcgcaccaagtggtcccccacacccaacagtattaacccggtgtggaacgag
gagccttttgtgttcgaaaagatcctgcttccagaaatggcctctctgagaattgtggct
cacgaagagaacggtaaattcttgggacacaggatcatcccccttgatgccatccaatca
ggtttccatcacatctgcctgcacagtgagagcaacatgccgctcactctgccctctgtc
ttcgtgtacatcgaggtcaaggactacatccctgctgcattcgcagattttacagatgcc
ttattcaatccaacaaagggcaacgagaaaacctcaaagaccccgaaggagtcctcctca
gactacattagtccttatgagctgcctctcatgactcagacctctgcaaacgatgcaaag
gaagctgaatctccggctgcagaaaaggctgcagcaccaacaccaccagccgatgtagga
gaggagtcgactgaacctcgaccagaaacaagcacggccgatcctgcagagaacgtgcca
gaagctgaagcaacctgctccgaacctgctgcagacgcagcagctgaggaggcgtctcca
gatccaggccctgtcacagctgaacccccccctgaagctggtccgcccgcagacgcggct
gcagagcaggaagaggttccagagccggaggtgtccaacgaggacacaaccagcgacccc
gacacaaacacagagccgtctccaggtgacaacgctgcagccggcgctgctaacgaagct
gctaacgaagctgctaatgaagctgctaacgaagctgctgctgtagctggtgcggctggc
ggagcggcccagtccgccggaggtgaaggctcagccccggcgcagatgtgcggtgaagag
cacgccacggtgacagctgaggaactgacacagcacaagaactacctgaaggccatcaaa
cgccaggagagagacatgaaggcggcagagaagaaatatcagaaaaagagcgaggatctg
atccagaaatactccgacaccttcaaggccatcaagaagaagatctcattgaagaaaaca
gagggaggggaaaactccacggacagcggcgtgaagagcgagcgtgtgcaggaccataaa
gaaaaaatgctggctgagctgcagctgcagtggaaggaacagtgtgaccatctgaggaag
aagaaggagcagtttgcaacagagaggctggccgtgctgctggagatggcaacagagcgg
cacaacagtgaactgaagatgctggagagtgaacccaaagataacaagaagaaaaccaaa
tgctcggacaaagccaagttgaaaagggcgatgagcacagagctgttggatgggccttgt
ttgatggcttgttcgctggaggaggagggtctgagcggggccctggtcaccatggagggg
tcgacaggaagaagcacacaaggacaaatgattgacatgtacaaagactgtgaccagtaa

DBGET integrated database retrieval system